DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS35 and mrps-35

DIOPT Version :9

Sequence 1:NP_523893.1 Gene:mRpS35 / 38345 FlyBaseID:FBgn0035374 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001256837.1 Gene:mrps-35 / 180240 WormBaseID:WBGene00012697 Length:365 Species:Caenorhabditis elegans


Alignment Length:320 Identity:113/320 - (35%)
Similarity:165/320 - (51%) Gaps:34/320 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDDEEFRVLSLRTVKQQMQKRQQVRR------------DPIT--PPRTGRMAVD-QDWTAVWPGP 85
            ||..|..|:..|.::.|.|..|...|            |.:|  |||:..|..: |.|..|||..
 Worm    48 EDFRELYVMPKRKLRGQTQLEQATGRTEYKTRSRFDLMDRLTKRPPRSEEMDPEAQKWCDVWPAA 112

  Fly    86 RSFHPASVPLPLRQGF---TERGAAAP-SKFANAELMKIPNFLHLTPPAIRQQCEAIKKFCTPW- 145
            |:|..:.||||:|.|.   .|:  .|| .|..|.||:|||||||||||||:|.|:||||||||: 
 Worm   113 RTFASSVVPLPVRMGTRPNVEK--RAPFKKEGNLELVKIPNFLHLTPPAIQQHCQAIKKFCTPFP 175

  Fly   146 PKGLETEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRVTITLKLSDLKFDAHARDKFLRLVGDRY 210
            |:.|...:...:|.|:.:..:.|.....:||:..:|.||:.:.:::||...:..:|.:||..:||
 Worm   176 PELLSNPSATCQHLPISIEYSTYIHQGTSIRDIRSRVVTMKIHVAELKLSENQMEKLIRLAANRY 240

  Fly   211 NKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVTEPWEATKSEADMEVYLFERNQSKVSAE 275
            ::.|..:|.:||||..::||.|||.||||..|||:...|.|:..|:..|.....|:.:.:|....
 Worm   241 DEKTGKMTIITDRCHTRQQNLDYAHYLLTVLYHEAQKVEKWDELKNRTDALKVEFDGSNTKTKLI 305

  Fly   276 GILNWNAKKGAPKVVPSKS----------FAECVEKLINEGENEYNLGKYKEEVKKMLNI 325
            .:|  ...|..|.:.||.:          |.|..:...|..|......:|..::||:|.|
 Worm   306 DLL--EKAKLTPGLSPSAAGCGDQKSIDEFGEMWKAYRNSEETVEKTREYGRQMKKLLGI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS35NP_523893.1 MRP-S28 160..281 CDD:287217 39/120 (33%)
mrps-35NP_001256837.1 MRP-S28 190..296 CDD:393435 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162173
Domainoid 1 1.000 93 1.000 Domainoid score I4795
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11048
Inparanoid 1 1.050 171 1.000 Inparanoid score I2745
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1339087at2759
OrthoFinder 1 1.000 - - FOG0007228
OrthoInspector 1 1.000 - - oto17936
orthoMCL 1 0.900 - - OOG6_107549
Panther 1 1.100 - - LDO PTHR13490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4329
SonicParanoid 1 1.000 - - X5333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.