DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12093 and TP53I13

DIOPT Version :9

Sequence 1:NP_647747.1 Gene:CG12093 / 38343 FlyBaseID:FBgn0035372 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_612358.3 Gene:TP53I13 / 90313 HGNCID:25102 Length:393 Species:Homo sapiens


Alignment Length:129 Identity:38/129 - (29%)
Similarity:59/129 - (45%) Gaps:22/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 SHLPATNGPYRPMPAEYGTYSYLPPQRYVRNLAEGAIVMLYHPCAFPGQVKQLQDIVGGCLYRHL 293
            :|.|.:..|..|..:...||:.:.|.:     ||. :..||||||.|....||..:...|:....
Human    35 AHCPESLWPLPPQVSPRVTYTRVSPGQ-----AED-VTFLYHPCAHPWLKLQLALLAYACMANPS 93

  Fly   294 VSPSLALSPQRPLALLAWSRSLEMSVVDRQLAADFIQKHAKQ---------------GPLAPEE 342
            ::|..:|:..|||.|.||..:|||:.|:...||.::.:..::               || ||.|
Human    94 LTPDFSLTQDRPLVLTAWGLALEMAWVEPAWAAHWLMRRRRRKQRKKKAWIYCESLSGP-APSE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12093NP_647747.1 DUF3105 223..341 CDD:288196 36/126 (29%)
TP53I13NP_612358.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..306
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E13B
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34179
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7425
SonicParanoid 1 1.000 - - X5497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.