DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12093 and Tp53i13

DIOPT Version :9

Sequence 1:NP_647747.1 Gene:CG12093 / 38343 FlyBaseID:FBgn0035372 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001099288.1 Gene:Tp53i13 / 287550 RGDID:1559818 Length:388 Species:Rattus norvegicus


Alignment Length:89 Identity:30/89 - (33%)
Similarity:43/89 - (48%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 LPPQRYVR--------NLAEGAIVMLYHPCAFPGQVKQLQDIVGGCLYRHLVSPSLALSPQRPLA 307
            ||||...|        ..||| |...|||||......||..:...|:.:..:.|..:|...|||.
  Rat    44 LPPQVLPRVTYTQVRQGQAEG-ITFFYHPCAHLWLKLQLAVLAHLCVAKPTLIPDFSLPWDRPLV 107

  Fly   308 LLAWSRSLEMSVVDRQLAADFIQK 331
            |.||..:|||:.::...||.::::
  Rat   108 LTAWGTALEMAWIEPAWAAQWLKR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12093NP_647747.1 DUF3105 223..341 CDD:288196 30/89 (34%)
Tp53i13NP_001099288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345714
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E13B
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34179
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.890

Return to query results.
Submit another query.