DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12093 and Y41C4A.8

DIOPT Version :9

Sequence 1:NP_647747.1 Gene:CG12093 / 38343 FlyBaseID:FBgn0035372 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_499515.1 Gene:Y41C4A.8 / 176603 WormBaseID:WBGene00012755 Length:233 Species:Caenorhabditis elegans


Alignment Length:221 Identity:80/221 - (36%)
Similarity:128/221 - (57%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 KQSSCDDGKSNLAVDFDPNDIRDSLNFLCISSNHSLYQPDLSRE--AILTEHFLPSAYLPPA--- 219
            |.::||||.:||..|:|..|..   .|.|::|.|...|.|:..|  .::.::   |:|.|..   
 Worm    24 KLTTCDDGITNLIKDWDSKDFS---AFTCLNSIHYAVQKDIDSEFFDMVQQN---SSYDPKKDQV 82

  Fly   220 --KCLNESISYSHLPATNGPYRPMPAEYGTYSYLPPQRYVRNLAEGAIVMLYHPCAFPGQVKQLQ 282
              :|::|:|.|.......|.:||..|.:|.|.|:|.||::.||..|:||:|||||....::.:|:
 Worm    83 MHRCMDETIDYEDRIPIRGDHRPNWARFGEYLYVPVQRWLHNLEHGSIVLLYHPCVDLDELNKLR 147

  Fly   283 DIVGGCLYRHLVSPSLALSPQRPLALLAWSRSLEMSVVDRQLAADFIQKHAKQGPLAPEELSRLI 347
            .:|..|:|||:::|.:.|:.:|||||:.|...|||:.||.:...:|::|:   |..||||::|  
 Worm   148 QLVTSCIYRHVITPYIKLTAERPLALVGWGSRLEMNSVDEKKVVEFMKKY---GNRAPEEITR-- 207

  Fly   348 VKRQTYKEGLLREAHLVNTADDYELC 373
              ...|.|.||:||..| :.:|..:|
 Worm   208 --DGLYDEYLLKEAKPV-SENDKTIC 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12093NP_647747.1 DUF3105 223..341 CDD:288196 46/117 (39%)
Y41C4A.8NP_499515.1 DUF3105 87..203 CDD:288196 46/118 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162407
Domainoid 1 1.000 111 1.000 Domainoid score I3946
eggNOG 1 0.900 - - E1_2E13B
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16431
Inparanoid 1 1.050 137 1.000 Inparanoid score I3118
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0011880
OrthoInspector 1 1.000 - - oto17501
orthoMCL 1 0.900 - - OOG6_110757
Panther 1 1.100 - - LDO PTHR34179
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7425
SonicParanoid 1 1.000 - - X5497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.