DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12093 and tp53i13

DIOPT Version :9

Sequence 1:NP_647747.1 Gene:CG12093 / 38343 FlyBaseID:FBgn0035372 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_001338803.3 Gene:tp53i13 / 100002736 ZFINID:ZDB-GENE-131121-569 Length:465 Species:Danio rerio


Alignment Length:249 Identity:78/249 - (31%)
Similarity:113/249 - (45%) Gaps:59/249 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CDDGKSNLAVDF-DPNDIRDSLNFLC--ISSNHSLYQPDLSREAILTEHFL-PSAYLPPAKCLNE 224
            ||:||:||.:|. .|.::      ||  :.....|..||..     |.|.: .|.|:    |::.
Zfish    25 CDNGKTNLVMDLPGPEEL------LCQELWPQSQLNVPDTD-----TNHIVEASDYI----CMDT 74

  Fly   225 SISYSHLPATNGPYRPMPAEYGTYSYLPPQRYVRNLAEGAIVMLYHPCAFPGQVKQLQDIVGGCL 289
            .|.|:....|:|.|||:.||.|.|.|.||||::.||..|.:|.|||||......:.|..:...||
Zfish    75 PIKYNESLPTHGDYRPVEAESGEYIYCPPQRWLNNLKNGGLVFLYHPCVSAEARRSLAVLAHSCL 139

  Fly   290 YRHLVSPSLALSPQRPLALLAWSRSLEMS-----VVDRQLAA----------------DFIQKHA 333
            ..::::|...||..||||:::|.||||||     |.|..|:.                .::.|.|
Zfish   140 SHYILTPHPWLSQHRPLAVVSWGRSLEMSQITLRVCDWLLSIFPNITLFSTSHGVKYNMYLTKPA 204

  Fly   334 KQGPL-APEELSR--------------LIVKRQTYKEGLLREAHLVNTADDYEL 372
            ...|: ..:|:||              |.:||.|.|..:.    |..:.:|.||
Zfish   205 LHKPVNTSQEMSRVERLKSLKHCCMRILSLKRITRKTRMA----LKQSPEDAEL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12093NP_647747.1 DUF3105 223..341 CDD:288196 48/139 (35%)
tp53i13XP_001338803.3 DUF3105 72..168 CDD:288196 40/95 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586688
Domainoid 1 1.000 94 1.000 Domainoid score I7484
eggNOG 1 0.900 - - E1_2E13B
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0011880
OrthoInspector 1 1.000 - - oto41072
orthoMCL 1 0.900 - - OOG6_110757
Panther 1 1.100 - - LDO PTHR34179
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7425
SonicParanoid 1 1.000 - - X5497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.