DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL1 and Ahcy

DIOPT Version :9

Sequence 1:NP_647746.1 Gene:AhcyL1 / 38342 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_057870.3 Gene:Ahcy / 269378 MGIID:87968 Length:432 Species:Mus musculus


Alignment Length:426 Identity:221/426 - (51%)
Similarity:306/426 - (71%) Gaps:3/426 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGA 161
            |.:||.. |:||:.::|||.||||::.:::..:..||||.|:|.||.|:..:|||||||||.|||
Mouse     9 VADIGLA-AWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGA 72

  Fly   162 SVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENWQPNMILDDGGDATH 226
            .|||::|||:|||:..|||:|::|||:|||:|||:|::.|||::.::.::...|||||||||.|:
Mouse    73 EVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTN 137

  Fly   227 LMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDS 291
            |:..|||.:...::||.||:.||||.||::...|.|.|||:||||||||:||||||.|:||::|.
Mouse   138 LIHTKYPQLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDG 202

  Fly   292 LKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIR 356
            :||:||||..||..||.|||||||||||||:|.|..|.|||||||.||||:|:|:.|..::|..:
Mouse   203 IKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACK 267

  Fly   357 NVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWPE 421
            ..:|.||.||..::::..|.::||...||||:||.:.||||..|....:....::.|||......
Mouse   268 EGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKN 332

  Fly   422 GKYIILLAEGRLVNLSCS-SIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVAS 485
            |:.||||||||||||.|: ..|||.:|.:...|.:|.|||: ..|.:|...|:.||||:||.||.
Mouse   333 GRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELW-THPDKYPVGVHFLPKKLDEAVAE 396

  Fly   486 LHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521
            .||...:..||:|:::||:|:|:...|||||::|||
Mouse   397 AHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:336064 218/423 (52%)
AhcyNP_057870.3 AdoHcyase 8..431 CDD:214963 218/423 (52%)
NAD binding. /evidence=ECO:0000250 183..350 90/166 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.