DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL1 and AHCY

DIOPT Version :9

Sequence 1:NP_647746.1 Gene:AhcyL1 / 38342 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001309015.1 Gene:AHCY / 191 HGNCID:343 Length:434 Species:Homo sapiens


Alignment Length:427 Identity:220/427 - (51%)
Similarity:307/427 - (71%) Gaps:3/427 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELG 160
            |..:||.. |:||:.::|||.||||::.:::|.:..||||.|:|.||.|:..:|||||||||.||
Human    10 CEADIGLA-AWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLG 73

  Fly   161 ASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENWQPNMILDDGGDAT 225
            |.|:|::|||:|||:..|||:|::|||::||:|||:|::.|||::.:..::...|||||||||.|
Human    74 AEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLT 138

  Fly   226 HLMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILD 290
            :|:..|||.:...::||.||:.||||.||::...|.|.|||:||||||||:||||||.|:||::|
Human   139 NLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLID 203

  Fly   291 SLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVI 355
            .:||:||||..||..||.|||||||||||||:|.|..|.|||||||.||||:|:|:.|..::|..
Human   204 GIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEAC 268

  Fly   356 RNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWP 420
            :..:|.||.||..::::..|.::||...||||:||.:.||||..|....:....::.|||.....
Human   269 QEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLK 333

  Fly   421 EGKYIILLAEGRLVNLSCS-SIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVA 484
            .|:.||||||||||||.|: ..|||.:|.:...|.:|.|||: ..|.:|...|:.||||:||.||
Human   334 NGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELW-THPDKYPVGVHFLPKKLDEAVA 397

  Fly   485 SLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521
            ..||...:..||:|:::||:|:|::..|||||::|||
Human   398 EAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:336064 217/424 (51%)
AHCYNP_001309015.1 AdoHcyase 10..433 CDD:283003 217/424 (51%)
PRK05476 12..428 CDD:235488 213/417 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.