DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL1 and ahcyl1

DIOPT Version :9

Sequence 1:NP_647746.1 Gene:AhcyL1 / 38342 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001121447.1 Gene:ahcyl1 / 100158541 XenbaseID:XB-GENE-942022 Length:278 Species:Xenopus tropicalis


Alignment Length:212 Identity:143/212 - (67%)
Similarity:166/212 - (78%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KKTSRYRSRSLSASSTDSFSSASYTGSSEDGDDVPPREKVQKNSKGSSDFCVRNIGAQHAFGRRE 110
            |...|..|||:|.|||||:||.|      ..|:..||:|.|..||||:||||:|| .|..|||||
 Frog    46 KTGRRSLSRSISQSSTDSYSSDS------SDDETSPRDKQQITSKGSADFCVKNI-KQADFGRRE 103

  Fly   111 IEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGASVRWAACNIYSTQN 175
            ||||||||..:|:|:|||..:|||..|||||||||.|||.||||||..|||..||:|||||||||
 Frog   104 IEIAEQEMMALISLRKRAQGEKPLLGAKIVGCTHITAQTGVLIETLCALGAQCRWSACNIYSTQN 168

  Fly   176 EVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAEN-WQPNMILDDGGDATHLMLKKYPTMFKLV 239
            ||||||||||:.||||:||:|:||||||||||||:: ||.|||||||||.||.:.||||.::|.:
 Frog   169 EVAAALAESGVAIFAWKGESEDDFWWCIDRCVNADSGWQANMILDDGGDLTHWVYKKYPHVYKQI 233

  Fly   240 KGIVEESVTGVHRLYQL 256
            :||||||||||||.:.|
 Frog   234 RGIVEESVTGVHREFGL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:336064 120/164 (73%)
ahcyl1NP_001121447.1 NADB_Rossmann 88..>246 CDD:304358 117/158 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 282 1.000 Domainoid score I1628
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 779 1.000 Inparanoid score I520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 1 1.000 - - FOG0003070
OrthoInspector 1 1.000 - - otm48575
Panther 1 1.100 - - O PTHR23420
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2437
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.