DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and SNF12

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_014420.1 Gene:SNF12 / 855757 SGDID:S000005306 Length:566 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:43/226 - (19%)
Similarity:80/226 - (35%) Gaps:68/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DADLATISAKRVREQVEGKL--NCSLLSRKKE-----FDKIVMEVINEQQDE---------EDED 67
            :|||..:.......::||:|  |.......:|     .:.||::..|::.|.         .:|:
Yeast   145 EADLMALENATWTMRIEGRLLDNVQANDPAREKFSSFIESIVVDFKNKENDNVPSTKFNAAPEEN 209

  Fly    68 DDEGKD--------------PDADPDDESEPSEEEDPSSSEEEAAKKKKQSPKKRPQPTKHKAPK 118
            ..||..              |:.  |:.:..:.:::.::..||.|||...|          ..||
Yeast   210 ATEGPSDKKLNLNLPLQFSLPNG--DNSTTTNTDQNNATMGEETAKKDMSS----------TTPK 262

  Fly   119 KKRKTLNADDSGTESDAGSDSDYEVVKKPAAKKKAKAAGGTGSG---------RKSTGFTRAYNL 174
            .:......|.:......|.|     :|:            .||.         |||:......:.
Yeast   263 LESVKWQYDPNNPVDFDGLD-----IKR------------VGSENVECTISILRKSSPEEPFMSY 310

  Fly   175 SPELSALMGESSLPRHEVVKKVWAIIKERDL 205
            ||:|:|::|..|...|:.:..::..|...:|
Yeast   311 SPQLTAIIGLKSGTSHDAIFSIYKYIHLNEL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 10/44 (23%)
SWIB 170..242 CDD:280380 9/36 (25%)
SNF12NP_014420.1 Rsc6 121..464 CDD:227818 43/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.