DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and TRI1

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_013960.1 Gene:TRI1 / 855273 SGDID:S000004846 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:54/232 - (23%)
Similarity:106/232 - (45%) Gaps:47/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IQAVLKDADLATISAKRVREQVEGKLNCSLLSRKKEFDKIVMEVINEQQDEEDEDDDEGKDPDAD 77
            :.|:|..::...||.||||:.::...:.:|.|::|..:::::|...:.|:          :|...
Yeast    11 VDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQE----------NPRVL 65

  Fly    78 PDDESEPSEEEDPSSSEEEAAKKKKQSPKKRPQPTKHKAPKKKRKTLNADDSGTESDAGSDSDYE 142
            .......|.:::.|...::..::..:|.:||...::.|:.:||:|    :||   .|:.|.|..:
Yeast    66 IPKNDLISRDQELSLRLQKEEERPLRSTRKRKGKSESKSKRKKKK----NDS---PDSNSISVRK 123

  Fly   143 VVKKPAAKKKAKAAGGTGSGRKSTGFTRAYNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYD 207
            |:                             ||..|...:|...|||.:|||.:|..|||.||.:
Yeast   124 VL-----------------------------LSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQN 159

  Fly   208 PKNKQFAICDDELMKVMKIRRFRTFGMLKHLKPHFLD 244
            ||:::..:||:::..:.. ::...|.|.|.|..|..:
Yeast   160 PKDRREILCDEKMEPIFG-KKMTMFSMNKLLTKHLFN 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 12/43 (28%)
SWIB 170..242 CDD:280380 24/71 (34%)
TRI1NP_013960.1 Rsc6 1..226 CDD:227818 54/232 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344412
Domainoid 1 1.000 52 1.000 Domainoid score I2840
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1758
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53067
OrthoFinder 1 1.000 - - FOG0002185
OrthoInspector 1 1.000 - - otm46913
orthoMCL 1 0.900 - - OOG6_104393
Panther 1 1.100 - - LDO PTHR13844
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.