DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and RSC6

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_009981.1 Gene:RSC6 / 850419 SGDID:S000000648 Length:483 Species:Saccharomyces cerevisiae


Alignment Length:276 Identity:42/276 - (15%)
Similarity:91/276 - (32%) Gaps:75/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISSEDLRREIQAVLK----DADLATISAKRVREQVEGKLNCSLLSR-------KKEFDKIVMEV 56
            |.:..:.|.||...|:    :.::.......::.|.:..|.||:..:       |.::...:..:
Yeast   177 DSAEAESREEIVDALEWNYDENNVVEFDGIDIKRQGKDNLRCSITIQLRGVDGGKVQYSPNLATL 241

  Fly    57 INEQQDEEDE-----------------DDDEGKDPDADPDDESEPSEEEDPSSSEEEAAKKKKQS 104
            |..|....::                 :..|.:|...|.:|.|..:..::.:..::..   :..:
Yeast   242 IGMQTGSVNDAVYSIYKYILINNLFVTEQTEAQDGSNDAEDSSNENNNKNGAGDDDGV---EGST 303

  Fly   105 PKKRPQPTKHKAPKKKRKTLNADDS-----------------------GTESDAGSDSDY----- 141
            ||.:|:..:.|.....:|.|:.:.:                       ....|...|:.|     
Yeast   304 PKDKPELGEVKLDSLLQKVLDTNAAHLPLMNVVQTVNKLVSPLPPIILDYTIDLSKDTTYGATTL 368

  Fly   142 -----EVVKKP-----AAKKKAKAAGGTGSGRKSTGFTRAYNLSPELSALMGESSL-PRHEVVKK 195
                 .::.:|     ..|::...|..|...|:.|......|.|.:......|.|| ||..:...
Yeast   369 DVDVSHILHQPQPQPNLQKEEETDAEDTAKLREITKLALQLNSSAQKYQFFHELSLHPRETLTHY 433

  Fly   196 VWA-----IIKERDLY 206
            :|:     ::.:.|.|
Yeast   434 LWSSKQNELVLQGDQY 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 9/60 (15%)
SWIB 170..242 CDD:280380 10/43 (23%)
RSC6NP_009981.1 Rsc6 88..392 CDD:227818 28/217 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.