DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and AT1G49520

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_175375.2 Gene:AT1G49520 / 841376 AraportID:AT1G49520 Length:372 Species:Arabidopsis thaliana


Alignment Length:332 Identity:81/332 - (24%)
Similarity:127/332 - (38%) Gaps:103/332 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISSEDLRREIQAVLKDADLATISAKRVREQVEGKLNCSLLSRK----KEFDKIV-MEVINEQQDE 63
            :|..||..:::.:|:.:||.|.:...||.|:|......|..:|    ::.|..: .:.:.|.:.|
plant     2 VSDSDLVTQLREILRSSDLETTTPASVRRQLEVYFGVELTDKKAFVREQIDAFLESDALLESKPE 66

  Fly    64 EDEDDDEGKDPDADPDDESEPSEEEDPSSSEEEAAKKK--------KQSPK----------KRPQ 110
            ::|:|..|     |.:|| |.||.:|..:.....|||:        :.||:          .|.:
plant    67 QEEEDCNG-----DQNDE-EGSENDDDKTELPVKAKKRGGGFNKICQLSPQLEKFLGTSQLARTE 125

  Fly   111 PTKH----------KAPKKKR--------------KTLN-------------------------- 125
            ..|.          :.|..:|              ||:|                          
plant   126 VVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMFQMNKALAKHIWALNDGDGCFKNVK 190

  Fly   126 ---ADDSGTESDAGSDSDYEV------------------VKKPAAKKKAKAAGGTGSGRKSTGFT 169
               .|::..|.|   :.|.::                  |:|...||:..|.......:|..|||
plant   191 EEDVDETSGERD---EKDVKIEEALENNEEESREEEDRSVRKRKRKKRKPAKSEEKPKKKGGGFT 252

  Fly   170 RAYNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFRTFGM 234
            :..:|||||.|..|...|.|.||||.:|..|||.:|.||.:|:..|||:.|..:..:.....|.|
plant   253 KVCSLSPELQAFTGTPQLARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFPVESINMFQM 317

  Fly   235 LKHLKPH 241
            .|.|..|
plant   318 NKQLAKH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 13/54 (24%)
SWIB 170..242 CDD:280380 30/72 (42%)
AT1G49520NP_175375.2 DEK_C 2..55 CDD:400903 14/52 (27%)
SWIB-MDM2_like 106..176 CDD:349489 9/69 (13%)
SWIB-MDM2_like 255..325 CDD:349489 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3553
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I2444
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503706at2759
OrthoFinder 1 1.000 - - FOG0002185
OrthoInspector 1 1.000 - - otm3103
orthoMCL 1 0.900 - - OOG6_104393
Panther 1 1.100 - - LDO PTHR13844
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.