DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and AT4G26810

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001119064.1 Gene:AT4G26810 / 828788 AraportID:AT4G26810 Length:106 Species:Arabidopsis thaliana


Alignment Length:97 Identity:30/97 - (30%)
Similarity:45/97 - (46%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 PAAKKKAKAAGGTGSGRKSTGFTRAYNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNK 211
            |...|||.    |.:.:|........||...|...:|:|.:.|.....:||:.||..:|.|||||
plant     3 PQRLKKAI----TDNPKKLGNLIDLVNLPSTLRNFVGQSQISRLGCFMRVWSYIKTNNLQDPKNK 63

  Fly   212 QFAICDDELMKV-MKIRRFRTFGMLKHLKPHF 242
            ...|||::|..: :..:|.....:...:|.||
plant    64 NVVICDEKLKSILLGKQRVELVDLPSLIKLHF 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 22/72 (31%)
AT4G26810NP_001119064.1 SWIB 24..95 CDD:396672 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503706at2759
OrthoFinder 1 1.000 - - FOG0002185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.