DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and AT3G03590

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_566210.1 Gene:AT3G03590 / 821215 AraportID:AT3G03590 Length:143 Species:Arabidopsis thaliana


Alignment Length:136 Identity:45/136 - (33%)
Similarity:61/136 - (44%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RKTLNADDSGTES--DAGSDSDYEVVKKPAAKKKAKA-----AGGTGSGRK---STGFTRAYNLS 175
            |..|......|.|  .|||      .||||||.||||     |......:|   |||..:...:|
plant    13 RSLLAPASRATSSLVSAGS------TKKPAAKPKAKAKPKPKAKSDSPAKKTPRSTGIFKVTPVS 71

  Fly   176 PELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFRTFGML---KH 237
            |.|:..:|.....|.:.:|.:|..||..||.:|.:|:...||:.|..:.:.:  ...|.|   |.
plant    72 PVLAQFLGTGETSRTDAIKGIWTYIKSHDLQNPADKREIFCDETLKLIFEGK--DKVGFLEISKL 134

  Fly   238 LKPHFL 243
            |.|||:
plant   135 LSPHFV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 21/74 (28%)
AT3G03590NP_566210.1 SWIB 69..139 CDD:396672 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503706at2759
OrthoFinder 1 1.000 - - FOG0002185
OrthoInspector 1 1.000 - - otm3103
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.