DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and AT3G01890

DIOPT Version :10

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_566154.2 Gene:AT3G01890 / 820093 AraportID:AT3G01890 Length:458 Species:Arabidopsis thaliana


Alignment Length:66 Identity:19/66 - (28%)
Similarity:30/66 - (45%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFRTFGMLK 236
            :..||.|..::|.....|..::..:|..:|.|.|.:|.:..|..||..|..|....:.: |.||.
plant   250 FKTSPALMQVLGIEVDTRPRIIAAIWHYVKVRKLQNPNDPSFFNCDAALHSVFGEEKMK-FTMLS 313

  Fly   237 H 237
            |
plant   314 H 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 5..57 CDD:462592
SWIB-MDM2_like 172..242 CDD:349489 19/66 (29%)
AT3G01890NP_566154.2 SWIB_like 253..320 CDD:349490 19/63 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.