DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and AT2G14880

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_565366.1 Gene:AT2G14880 / 815977 AraportID:AT2G14880 Length:141 Species:Arabidopsis thaliana


Alignment Length:128 Identity:39/128 - (30%)
Similarity:61/128 - (47%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PKKKRKTLNADDSGTESDAGSDSDYEVVKKPAAKKKAKAAGGTGSGRKSTGFTRAYNLSPELSAL 181
            |..|.:.:.|..|.|||           .:|.|..|          |...|..:...:|||:..:
plant    35 PAAKLRLVRAVTSATES-----------SEPTATNK----------RVPRGIMKPRPVSPEMQDI 78

  Fly   182 MGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIR-RFRTFGMLKHLKPHFL 243
            :....:.|.:.:|::||.|||.||.||:||:..:||::|.|:.:.| |.....:.|.:.||||
plant    79 VELPEIARTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGRDRVGFLEIAKLIGPHFL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 24/72 (33%)
AT2G14880NP_565366.1 SWIB 67..140 CDD:396672 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503706at2759
OrthoFinder 1 1.000 - - FOG0002185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104393
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.