DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and Smarcd3

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_006535860.1 Gene:Smarcd3 / 66993 MGIID:1914243 Length:535 Species:Mus musculus


Alignment Length:248 Identity:50/248 - (20%)
Similarity:88/248 - (35%) Gaps:63/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KDADLATISAKRVREQV-EGKLNCSLLSRKKEFDKIVM-------EVINEQQDEEDE------DD 68
            |.||  .|..:|:||.| |.:....||:.:::.|:.:|       |.:.....::.:      :.
Mouse   102 KMAD--KILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNT 164

  Fly    69 DEGKDPDADPDDESEPSEE--------EDPSSSEEEAAKKKK----QSPKKRPQPTKHKAPKKKR 121
            .....|||:..|.|..|.|        :|||..:.:.:...|    :..|....|..|.....:.
Mouse   165 FNPAKPDAEDSDGSIASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRT 229

  Fly   122 KTLNADDSGTESDAGSDSDYEVVKKPAAKKKAKAAGGTGSGRKSTGFT---------RAYNLSPE 177
            .|.            .::|...||:|              |..|...|         ..:.|.|.
Mouse   230 PTT------------QETDGFQVKRP--------------GDLSVRCTLLLMLDYQPPQFKLDPR 268

  Fly   178 LSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFR 230
            |:.|:|..:..|..:|:.:|..:|...|.|..:|::...|....::....|.:
Mouse   269 LARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 14/46 (30%)
SWIB 170..242 CDD:280380 14/61 (23%)
Smarcd3XP_006535860.1 Rsc6 179..376 CDD:227818 31/169 (18%)
SWIB_BAF60C 265..338 CDD:349495 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839742
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.