DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and SMARCD2

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001091896.1 Gene:SMARCD2 / 6603 HGNCID:11107 Length:531 Species:Homo sapiens


Alignment Length:290 Identity:44/290 - (15%)
Similarity:75/290 - (25%) Gaps:148/290 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PDADPDDESEPSEEEDPSSSEEEAAKKKKQSPKKRPQPTKHKAPKKK-----------------R 121
            |.|.|           |..::....|::|.:.|..||..:...|:.:                 |
Human   122 PQAQP-----------PMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIAR 175

  Fly   122 KTLNADDSGTESDAGSDSDYEVVKKPAAKKK----------------------AKAAGGTGSG-- 162
            |.:...              |.:|||..:|:                      |...|||.:|  
Human   176 KRMEIQ--------------EAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDK 226

  Fly   163 --------------------RKSTGFTRA------------------------------------ 171
                                ||.:.|.::                                    
Human   227 VASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRP 291

  Fly   172 -------------------YNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICD 217
                               |.|.|.|:.|:|..:..|..:::.:|..||...|.|...:::..|:
Human   292 GDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCN 356

  Fly   218 DELMKVMKIRRFR-------TFGMLKHLKP 240
            ....::....|.|       ..|:|:|..|
Human   357 RYFRQIFSCGRLRFSEIPMKLAGLLQHPDP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 19/133 (14%)
SMARCD2NP_001091896.1 PHA03201 61..>148 CDD:165468 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..226 5/20 (25%)
SWIB_BAF60B 307..386 CDD:349494 18/78 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149692
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.