DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and smarcd3a

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_005163573.1 Gene:smarcd3a / 564652 ZFINID:ZDB-GENE-070912-491 Length:518 Species:Danio rerio


Alignment Length:278 Identity:54/278 - (19%)
Similarity:84/278 - (30%) Gaps:93/278 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ISAKR--VREQVEGKLNCSLLSRKKEFDKI----VMEVINEQQDEEDEDDDEGKDPDADPDDESE 83
            |||::  :||........|...|:|..|||    :.|::.|.|...|....|.|           
Zfish   100 ISARQMDMREAQSDPAIGSNAKRRKMADKILPQRIRELVPESQAYMDLLAFERK----------- 153

  Fly    84 PSEEEDPSSSEEEAAKKKK---QSPKKRPQPTKHKAPKKKRKTLNADDSGTESDAGS-------- 137
                      .::...:|:   |...|||...|.|.......|.|.....||...||        
Zfish   154 ----------LDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDTEDSEGSIASWELRV 208

  Fly   138 --------------------------DSD--------YEVVKKPAAKKKAKAAGGTGSGRKSTGF 168
                                      |.|        .|:..|.|||........|.:.:::.||
Zfish   209 EGKLLDDPGKQKRKFSSFFKSLVIELDKDLYGPDNHLVEIALKHAAKIGETQWHRTPTTQETDGF 273

  Fly   169 ---------------------TRAYNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQ 212
                                 ...:.|.|.|:.|:|..:..|..:::.:|..:|...|.|...|:
Zfish   274 QVKRPGDVNVRCTLLLMLDYQPPQFKLDPRLARLLGIHTQTRSCIIQALWQYVKTNKLQDSHEKE 338

  Fly   213 FAICDDELMKVMKIRRFR 230
            :..||....::....|.:
Zfish   339 YINCDKYFQQIFDCPRLK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 12/37 (32%)
SWIB 170..242 CDD:280380 14/61 (23%)
smarcd3aXP_005163573.1 Rsc6 201..411 CDD:227818 24/156 (15%)
SWIB 297..368 CDD:280380 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.