DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and smarcd2

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_692749.2 Gene:smarcd2 / 564317 ZFINID:ZDB-GENE-080215-1 Length:501 Species:Danio rerio


Alignment Length:76 Identity:19/76 - (25%)
Similarity:33/76 - (43%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFR------ 230
            |.|.|.|:.|:|..:..|..:::.:|..||...|.|...|::..|:....::....|.|      
Zfish   281 YKLDPRLARLLGVHTQTRASIMQALWLYIKNNKLQDCHEKEYINCNRYFRQIFGCPRMRFSDIPM 345

  Fly   231 -TFGMLKHLKP 240
             ...:|:|..|
Zfish   346 KLASLLQHPDP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 19/76 (25%)
smarcd2XP_692749.2 Forkhead_N 1..99 CDD:254796
Rsc6 200..400 CDD:227818 19/76 (25%)
SWIB 280..351 CDD:280380 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.