DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and smarcd2

DIOPT Version :10

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_692749.2 Gene:smarcd2 / 564317 ZFINID:ZDB-GENE-080215-1 Length:501 Species:Danio rerio


Alignment Length:76 Identity:19/76 - (25%)
Similarity:33/76 - (43%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFR------ 230
            |.|.|.|:.|:|..:..|..:::.:|..||...|.|...|::..|:....::....|.|      
Zfish   281 YKLDPRLARLLGVHTQTRASIMQALWLYIKNNKLQDCHEKEYINCNRYFRQIFGCPRMRFSDIPM 345

  Fly   231 -TFGMLKHLKP 240
             ...:|:|..|
Zfish   346 KLASLLQHPDP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 5..57 CDD:462592
SWIB-MDM2_like 172..242 CDD:349489 19/76 (25%)
smarcd2XP_692749.2 SWIB_BAF60B 277..356 CDD:349494 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.