powered by:
Protein Alignment Non2 and smarcd2
DIOPT Version :9
Sequence 1: | NP_647745.1 |
Gene: | Non2 / 38341 |
FlyBaseID: | FBgn0035370 |
Length: | 244 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_692749.2 |
Gene: | smarcd2 / 564317 |
ZFINID: | ZDB-GENE-080215-1 |
Length: | 501 |
Species: | Danio rerio |
Alignment Length: | 76 |
Identity: | 19/76 - (25%) |
Similarity: | 33/76 - (43%) |
Gaps: | 7/76 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 YNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFR------ 230
|.|.|.|:.|:|..:..|..:::.:|..||...|.|...|::..|:....::....|.|
Zfish 281 YKLDPRLARLLGVHTQTRASIMQALWLYIKNNKLQDCHEKEYINCNRYFRQIFGCPRMRFSDIPM 345
Fly 231 -TFGMLKHLKP 240
...:|:|..|
Zfish 346 KLASLLQHPDP 356
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170583826 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5531 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1401 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.860 |
|
Return to query results.
Submit another query.