DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and Smarcd3

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_006235950.1 Gene:Smarcd3 / 296732 RGDID:1311869 Length:495 Species:Rattus norvegicus


Alignment Length:254 Identity:55/254 - (21%)
Similarity:94/254 - (37%) Gaps:63/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KDADLATISAKRVREQV-EGKLNCSLLSRKKEFDKIVMEVINEQQDEEDEDDDEGK--------- 72
            |.||  .|..:|:||.| |.:....||:.:::.|:.:|....:.|:.......:.:         
  Rat   102 KMAD--KILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNT 164

  Fly    73 -DPDADPDDESEPSEEEDPSSSEEEAAKKKKQSPKKRPQPTKHKAP---KKKRK----------T 123
             :| |.||     :|:.|.|.:..|...:.|.....||.|.....|   |:|||          .
  Rat   165 FNP-AKPD-----AEDSDGSIASWELRVEGKLLDDVRPGPVPVTFPQPSKQKRKFSSFFKSLVIE 223

  Fly   124 LNADDSGTE--------SDAGSDSDYEVVKKPAAKKKAKAAGGTGSGRKSTGFT---------RA 171
            |:.|..|.:        :....::|...||:|              |..|...|         ..
  Rat   224 LDKDLYGPDNHLVEWHRTPTTQETDGFQVKRP--------------GDLSVRCTLLLMLDYQPPQ 274

  Fly   172 YNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFR 230
            :.|.|.|:.|:|..:..|..:|:.:|..:|...|.|..:|::...|....::....|.:
  Rat   275 FKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 13/39 (33%)
SWIB 170..242 CDD:280380 14/61 (23%)
Smarcd3XP_006235950.1 Rsc6 179..388 CDD:227818 34/169 (20%)
SWIB 274..345 CDD:280380 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.