DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non2 and ssr3

DIOPT Version :9

Sequence 1:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_593110.1 Gene:ssr3 / 2541438 PomBaseID:SPAC23G3.10c Length:425 Species:Schizosaccharomyces pombe


Alignment Length:265 Identity:53/265 - (20%)
Similarity:102/265 - (38%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISSEDLRREIQAVLKDADLATISAKRVREQVEGKLNCSLLSRKKEFDKIVME--VINE--QQDEE 64
            |:.:||.|::.:::            ||::.:.:.:.|..|.|....::.:.  |.|:  ||..|
pombe    48 IALQDLERKLDSLI------------VRKRFDLQDSLSRNSHKTRILRMYIHSTVANQSWQQKGE 100

  Fly    65 DEDDDEG-----KDPD----------ADPDDESEPSEEEDP-SSSEEEAAKKKKQSPKKRPQPTK 113
            :::::.|     ..|:          .:||||.:.:.|..| ::...:.|.:..:|....|....
pombe   101 NQENNSGDINSLPIPEWTLHIEGRLLVNPDDEDDKAFELAPFTNFFRKIAIQILRSDDLYPSGNY 165

  Fly   114 ---HKAPKKKRKTLNADDSGTESDAGSDS-DYEVVKKPAAKKKAKAAGGTGSGRKSTGFTRAYNL 174
               :|.|...    |..:..|.:..|..| |.:::..|....:                  .|.|
pombe   166 VEWNKLPDNS----NTSNGITVTRKGDQSVDVKIMLYPEEHPE------------------RYKL 208

  Fly   175 SPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFRTFGMLKHLK 239
            |...:.::|.....|.::|..:|..||...|.|.:.|:...||..|..:.:..|. .|..:..|.
pombe   209 SKAFANILGIREGTRPDIVSYLWQYIKFHRLQDMEEKRLINCDKALRDLFEADRL-YFPRIPELM 272

  Fly   240 PHFLD 244
            ..||:
pombe   273 NRFLE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919 8/51 (16%)
SWIB 170..242 CDD:280380 18/71 (25%)
ssr3NP_593110.1 Rsc6 82..325 CDD:227818 44/219 (20%)
SWIB 204..276 CDD:280380 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.