powered by:
Protein Alignment Non2 and K03B8.4
DIOPT Version :9
Sequence 1: | NP_647745.1 |
Gene: | Non2 / 38341 |
FlyBaseID: | FBgn0035370 |
Length: | 244 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505890.1 |
Gene: | K03B8.4 / 186925 |
WormBaseID: | WBGene00010523 |
Length: | 96 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 12/47 - (25%) |
Similarity: | 22/47 - (46%) |
Gaps: | 9/47 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 RHE-----VVKKVWAIIKERDLY----DPKNKQFAICDDELMKVMKI 226
||| |..::.|.:.::..| ..|.|:....:::|:|..||
Worm 47 RHELEQILVFDQIKAPLPKKKKYVDSKQVKKKRIIAKENQLVKQCKI 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Non2 | NP_647745.1 |
DEK_C |
7..57 |
CDD:285919 |
|
SWIB |
170..242 |
CDD:280380 |
12/47 (26%) |
K03B8.4 | NP_505890.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160158794 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5531 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.