powered by:
Protein Alignment Acp62F and CG42259
DIOPT Version :9
Sequence 1: | NP_523892.1 |
Gene: | Acp62F / 38340 |
FlyBaseID: | FBgn0020509 |
Length: | 115 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001036256.2 |
Gene: | CG42259 / 7354475 |
FlyBaseID: | FBgn0266569 |
Length: | 92 |
Species: | Drosophila melanogaster |
Alignment Length: | 46 |
Identity: | 15/46 - (32%) |
Similarity: | 17/46 - (36%) |
Gaps: | 4/46 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 CTANGTQTECPVACPETCEYSGNGPCVK---MCGAPCVCKPGYVIN 76
|.||.|...|...|...|...|. ||:. .|...|.|..|:..|
Fly 30 CPANETFLACGPDCQTECATLGK-PCLVRHIRCPDGCYCNKGFARN 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acp62F | NP_523892.1 |
TIL |
34..88 |
CDD:280072 |
15/46 (33%) |
CG42259 | NP_001036256.2 |
TIL |
30..85 |
CDD:280072 |
15/46 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.