powered by:
Protein Alignment Acp62F and CG5267
DIOPT Version :9
Sequence 1: | NP_523892.1 |
Gene: | Acp62F / 38340 |
FlyBaseID: | FBgn0020509 |
Length: | 115 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611154.2 |
Gene: | CG5267 / 36875 |
FlyBaseID: | FBgn0034154 |
Length: | 201 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 34/67 - (50%) |
Similarity: | 39/67 - (58%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRK 95
|..|..|.|...|...|||||||... .||.:||.||.||.|||.|....||.|||||||.:|:.
Fly 129 KFGCCHNSTYVGCAGVCPETCEYRSK-YCVPLCGPPCRCKRGYVYNIPHSACTLRSDCPKGIVQS 192
Fly 96 ED 97
::
Fly 193 KN 194
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acp62F | NP_523892.1 |
TIL |
34..88 |
CDD:280072 |
28/53 (53%) |
CG5267 | NP_611154.2 |
TIL |
132..185 |
CDD:334697 |
28/53 (53%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D138202at33392 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0014389 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.