DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp62F and CG5267

DIOPT Version :9

Sequence 1:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_611154.2 Gene:CG5267 / 36875 FlyBaseID:FBgn0034154 Length:201 Species:Drosophila melanogaster


Alignment Length:67 Identity:34/67 - (50%)
Similarity:39/67 - (58%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRK 95
            |..|..|.|...|...|||||||... .||.:||.||.||.|||.|....||.|||||||.:|:.
  Fly   129 KFGCCHNSTYVGCAGVCPETCEYRSK-YCVPLCGPPCRCKRGYVYNIPHSACTLRSDCPKGIVQS 192

  Fly    96 ED 97
            ::
  Fly   193 KN 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp62FNP_523892.1 TIL 34..88 CDD:280072 28/53 (53%)
CG5267NP_611154.2 TIL 132..185 CDD:334697 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138202at33392
OrthoFinder 1 1.000 - - FOG0014389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.