DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp62F and Y26D4A.12

DIOPT Version :9

Sequence 1:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001021738.1 Gene:Y26D4A.12 / 3564819 WormBaseID:WBGene00012509 Length:76 Species:Caenorhabditis elegans


Alignment Length:87 Identity:22/87 - (25%)
Similarity:33/87 - (37%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKICACLGLLLLFKPIDSMGWQGPKVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCV--- 68
            :|:...|.|:::...      |.|  .|.||.....|..||..:|:    .|..|.|...|:   
 Worm     1 MKLLILLALVIITVA------QTP--SCLANEEFRTCGTACEPSCQ----NPEPKTCNLKCIVNM 53

  Fly    69 --CKPGYVINERIPACVLRSDC 88
              |..|:|..:.  .||...:|
 Worm    54 CQCVNGFVRGDN--GCVRLQEC 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp62FNP_523892.1 TIL 34..88 CDD:280072 16/58 (28%)
Y26D4A.12NP_001021738.1 TIL 20..73 CDD:366828 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.