DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp62F and LOC3290243

DIOPT Version :10

Sequence 1:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_565386.3 Gene:LOC3290243 / 3290243 VectorBaseID:AGAMI1_011812 Length:121 Species:Anopheles gambiae


Alignment Length:66 Identity:22/66 - (33%)
Similarity:30/66 - (45%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKVDCT-ANGTQTECPVACPE-TCEYSGNG---PCVKMCGAPCVCKPGYVINERIPACVLRSDCP 89
            ||::|| ......||..:|.: |||....|   .|.|.|...|.|:.||| .::...|:....|.
Mosquito    54 PKIECTDPREVYNECGSSCDDRTCENIRRGDHLACTKHCVEGCFCRNGYV-RDKHDRCIPSYRCG 117

  Fly    90 K 90
            |
Mosquito   118 K 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp62FNP_523892.1 TIL 34..88 CDD:460351 18/58 (31%)
LOC3290243XP_565386.3 None

Return to query results.
Submit another query.