DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp62F and spi-2

DIOPT Version :10

Sequence 1:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001379552.1 Gene:spi-2 / 178914 WormBaseID:WBGene00015076 Length:166 Species:Caenorhabditis elegans


Alignment Length:72 Identity:22/72 - (30%)
Similarity:31/72 - (43%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PIDSMGWQGPKVDCTA-NGTQTECPVACPETCEYSGNGPCVKMC-GAPCVCKPGYVINERIPACV 83
            |:......|.::.|.. |.....|..||..:|. :.|..|.|.| ...|.|:.|||.||....||
 Worm    24 PVGGQVGGGQRLPCRGRNEEYKTCGTACEPSCT-NPNPMCTKQCINNVCQCRSGYVRNEITRQCV 87

  Fly    84 LRSDCPK 90
            .::.|.:
 Worm    88 RQAQCSR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp62FNP_523892.1 TIL 34..88 CDD:460351 19/55 (35%)
spi-2NP_001379552.1 TIL 39..92 CDD:410995 18/53 (34%)
TIL 113..166 CDD:410995
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.