DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp62F and LOC108648061

DIOPT Version :9

Sequence 1:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_031761705.1 Gene:LOC108648061 / 108648061 -ID:- Length:143 Species:Xenopus tropicalis


Alignment Length:102 Identity:32/102 - (31%)
Similarity:42/102 - (41%) Gaps:35/102 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CACLGLLLLFKPIDSMGW--QGPKVDC-------TANGTQT--ECPVACPETCEYSGNGP--CVK 61
            |||       ||    |:  |.|...|       ...|.:.  .|...||.||:     |  |..
 Frog    62 CAC-------KP----GYLRQTPDSPCIPKDKCIICEGLKVYDRCRGHCPPTCQ-----PKMCSY 110

  Fly    62 MCGAPCVCKPGYV-INERIPACVLRSDCPKDVVRKED 97
            ||...|:|:.||. .|||   |:.|..||  :|:::|
 Frog   111 MCVEGCICREGYAWHNER---CIPRWRCP--IVQQQD 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp62FNP_523892.1 TIL 34..88 CDD:280072 20/65 (31%)
LOC108648061XP_031761705.1 TIL 86..135 CDD:410995 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.