powered by:
Protein Alignment Acp62F and LOC100487969
DIOPT Version :9
Sequence 1: | NP_523892.1 |
Gene: | Acp62F / 38340 |
FlyBaseID: | FBgn0020509 |
Length: | 115 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002941834.2 |
Gene: | LOC100487969 / 100487969 |
-ID: | - |
Length: | 162 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 22/64 - (34%) |
Similarity: | 27/64 - (42%) |
Gaps: | 4/64 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KVDCTANGTQTECPVACPETCEYSGNGP-CVKMCGAPCVCKPGYVI---NERIPACVLRSDCPK 90
||.|.||.....|......||....:.| .:..|...|||..|:|| .|..|.|:..|:|.|
Frog 95 KVSCPANMHFDSCVKTDRRTCAMLNSTPNSLPSCVQRCVCDEGFVIADDTEEKPKCIKISECSK 158
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acp62F | NP_523892.1 |
TIL |
34..88 |
CDD:280072 |
18/57 (32%) |
LOC100487969 | XP_002941834.2 |
TIL |
37..94 |
CDD:410995 |
|
TIL |
98..156 |
CDD:410995 |
18/57 (32%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.