DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ProRS-m and AT5G10880

DIOPT Version :9

Sequence 1:NP_647737.1 Gene:ProRS-m / 38331 FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_196649.1 Gene:AT5G10880 / 830955 AraportID:AT5G10880 Length:309 Species:Arabidopsis thaliana


Alignment Length:269 Identity:61/269 - (22%)
Similarity:96/269 - (35%) Gaps:89/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SCNSSDLKE----VRGVEVAHTFLLGDKYSKPLGATFLNTT--GKPQSLVMGCYGIGITRVI--- 307
            :|...:|.|    |:|..:.....:.|:|.:    .:.|||  |..|.|      :|:..::   
plant    24 ACRFGELVEYYESVKGCYILKPSGISDEYLE----RYTNTTLKGLLQRL------LGLQELVDKR 78

  Fly   308 ------AAALEVLSSDHELRWPKLLAPYDVCLIG-PKQGSKEQPE----AEVIENELLLNVG--- 358
                  .||......|..|.:|..:||..|.:|. |.:|:.:..|    .|.:|: .||..|   
plant    79 TQGPPFEAACMTHGDDKGLVFPPKVAPVQVVVIHVPIKGAADYQELCDACEAVES-TLLGAGIRA 142

  Fly   359 EICGHQELLHDDRKELTIGKRLLEAKRLGHPLTIVVGAK--------------SARLD------- 402
            |.        |.|...:.|.:..:.:..|.||.|..|.:              .|::|       
plant   143 EA--------DIRDNYSCGWKYADQELTGVPLRIETGPRDLANDQVRIVTRDNGAKMDVKRGDLI 199

  Fly   403 ------------------SPKLEVHTSKGETYELDFSETLKLVAEHSQHKKSLERGCFQSETEES 449
                              ..|:|..|.|.||:: :|.|.|      ||.|..|...|.:.|.|:.
plant   200 EQVKDLLEKIQSNLYDVAKRKVEECTQKVETWD-EFVEAL------SQKKLILAPWCDKVEVEKD 257

  Fly   450 -KSRSVGHQ 457
             |.|:.|.:
plant   258 VKRRTRGDE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 49/231 (21%)
ProRS_core_prok 24..313 CDD:238402 16/75 (21%)
ProRS_anticodon_short 328..428 CDD:238438 31/146 (21%)
AT5G10880NP_196649.1 class_II_aaRS-like_core 16..>47 CDD:294192 5/22 (23%)
ProRS_anticodon_zinc 96..309 CDD:238439 44/187 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0442
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2688
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.