DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ProRS-m and ThrRS

DIOPT Version :9

Sequence 1:NP_647737.1 Gene:ProRS-m / 38331 FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001285868.1 Gene:ThrRS / 45784 FlyBaseID:FBgn0027081 Length:747 Species:Drosophila melanogaster


Alignment Length:454 Identity:82/454 - (18%)
Similarity:153/454 - (33%) Gaps:127/454 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KNAVVKQTEQLSRSQKL--LTELGLVKSGSNGTYQIMPMAQRSVDKCIDLVQSNMQQAGGQKITL 78
            :.|..:...::.|.|:|  ..||      |.|:....|......:..:..:::..::.|.|::..
  Fly   342 EEAAKRDHRKIGREQELFFFHEL------SPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVIS 400

  Fly    79 PILTPTGLWKKTGRLD---GDISEFYMVRDRSGKQFLMSPTHEEAVTAMLATTSPISYRQLPLRL 140
            |.:....||..:|...   .::..|...:::...:.:..|.|     .::......|:|:||||:
  Fly   401 PNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGH-----CLIFDNRNRSWRELPLRM 460

  Fly   141 FQIGPKFRDELKTRF-GLMRAKEFLMKDMYSFDVSEETAME----------TYTLVNAAY----- 189
            ...|...|:||.... ||.|.:.|...|.:.|...|:...|          .||:...::     
  Fly   461 ADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLS 525

  Fly   190 ---DRLFKQLE-----------------VPFVKVNAATGIMGGSVSHEYHYVSPVGEDNLLQCSS 234
               |....:||                 :|: |.|...|...|.      .:.....|.|.:...
  Fly   526 TRPDNYLGELEQWNDAEKALAESLNEFGMPW-KENPGDGAFYGP------KIDITIMDALKRAHQ 583

  Fly   235 CGFAGNSEVVKAPASCP-----SCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLNTTGKPQSL 294
            |.      .::.....|     |..:.|.::.|.| :.|..:||                     
  Fly   584 CA------TIQLDFQLPIRFNLSYIADDGEKKRPV-IIHRAILG--------------------- 620

  Fly   295 VMGCYGIGITRVIAAALEVLSSDHELRWPKLLAPYDVCL--IGP-----KQGSKEQPEAEVIENE 352
                   .:.|:||    :|:.:...:||..|:|..|.:  :||     .|..::|.......:|
  Fly   621 -------SVERMIA----ILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSE 674

  Fly   353 LLLNVGEICGHQELLHDDRKELTIGKRLLEAKRLGHPLTIVVGAKSARLDSPKLEVHTSK--GE 414
            ...:.|:               |:.|::..|:.......:|||.|....::..:....:|  ||
  Fly   675 ADCDAGD---------------TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGE 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 82/454 (18%)
ProRS_core_prok 24..313 CDD:238402 59/334 (18%)
ProRS_anticodon_short 328..428 CDD:238438 18/96 (19%)
ThrRSNP_001285868.1 PLN02908 79..740 CDD:178496 82/454 (18%)
TGS_ThrRS_N 109..170 CDD:133437
tRNA_SAD 276..323 CDD:197931
ThrRS_core 347..643 CDD:238394 63/352 (18%)
ThrRS_anticodon 643..734 CDD:238437 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.