DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ProRS-m and mRpL39

DIOPT Version :9

Sequence 1:NP_647737.1 Gene:ProRS-m / 38331 FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_524075.2 Gene:mRpL39 / 39627 FlyBaseID:FBgn0036462 Length:333 Species:Drosophila melanogaster


Alignment Length:174 Identity:42/174 - (24%)
Similarity:63/174 - (36%) Gaps:45/174 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 MYSFDVSEETAME------TYTLVNAAYDRLFK-----QLEVPFVKVNAATGIMGGSVSHEYHYV 221
            :.:|.|||...:.      ...::.||.:|.||     ||. .|...|    |..||..|     
  Fly   120 LLNFHVSEPHVVNKAFWRTCSFMLGAALNRAFKPEANLQLH-SFPGPN----IKSGSFVH----- 174

  Fly   222 SPVGEDNLLQCSSCGFAGNSEVVKAPASCPSCNSSDLKEVR---GVEVAHTFLLGDKY-SKPLGA 282
                 |.:||..:.. .|..|:....|......:.||:..|   ..::|.......|| |:.|.:
  Fly   175 -----DIVLQTQNWE-PGKEEMRALSAEMVKLAAQDLRIERLDVQQDLAQEMFKDSKYKSEQLPS 233

  Fly   283 TFLNTTGKPQSLVMGCYGIGITR-------------VIAAALEV 313
            ....|.|:.....:|.: |.|:|             ||:||.:|
  Fly   234 ISQQTNGRVTLYRLGDH-IDISRGPMVASTSFLGKCVISAAHKV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 42/174 (24%)
ProRS_core_prok 24..313 CDD:238402 41/172 (24%)
ProRS_anticodon_short 328..428 CDD:238438
mRpL39NP_524075.2 TGS_ThrRS_N 65..123 CDD:133437 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42753
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.