DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEP-1 and zbtb12.1

DIOPT Version :9

Sequence 1:NP_001137875.1 Gene:MEP-1 / 38327 FlyBaseID:FBgn0035357 Length:1152 Species:Drosophila melanogaster
Sequence 2:NP_001038352.1 Gene:zbtb12.1 / 559143 ZFINID:ZDB-GENE-060503-875 Length:483 Species:Danio rerio


Alignment Length:168 Identity:38/168 - (22%)
Similarity:60/168 - (35%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   941 SGNNKAQFVICEICDGYIKDLEQLRNHMQWMHKVKIHPKMIYNRPPLNCQKCQFRFFTDQGLERH 1005
            |.:|....|:||.|.......:.|.     ||.:..|.:.|       |..|:.:|...:.|.||
Zfish   347 STSNVTGPVVCEQCGLAFSSTQDLA-----MHSLSAHQQYI-------CPCCRKQFSNSRNLNRH 399

  Fly  1006 LLGSHGLVTSSMQEAANKGKDAGR---CPVCGRMYQWKLLNHVSRDHHMTLKPAHLSYKCTVCTA 1067
            :| .|              :|..|   ||:|.:.:..|...:    .||.:......|.|..|..
Zfish   400 ML-LH--------------RDNSRLPSCPLCHKTFTQKSTMY----DHMNVHSGERPYVCAYCPI 445

  Fly  1068 TFGMYKQFETHVYTAH-STVARKAMDSKKNSAQSSGSG 1104
            :|........|:...| .|:.:...:.::|. .|.|.|
Zfish   446 SFAHRSALRRHLLEQHGKTMPQNHQEMQRNK-HSIGEG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEP-1NP_001137875.1 BSP_II <121..>226 CDD:283165
C2H2 Zn finger 951..977 CDD:275371 6/25 (24%)
C2H2 Zn finger 989..1010 CDD:275371 7/20 (35%)
zbtb12.1NP_001038352.1 BTB 21..122 CDD:279045
BTB 32..125 CDD:197585
C2H2 Zn finger 357..378 CDD:275368 6/25 (24%)
C2H2 Zn finger 383..403 CDD:275368 7/20 (35%)
C2H2 Zn finger 412..432 CDD:275368 6/23 (26%)
zf-H2C2_2 428..449 CDD:290200 6/20 (30%)
C2H2 Zn finger 440..457 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.