DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEP-1 and F56D1.1

DIOPT Version :9

Sequence 1:NP_001137875.1 Gene:MEP-1 / 38327 FlyBaseID:FBgn0035357 Length:1152 Species:Drosophila melanogaster
Sequence 2:NP_495042.3 Gene:F56D1.1 / 186375 WormBaseID:WBGene00018959 Length:454 Species:Caenorhabditis elegans


Alignment Length:575 Identity:102/575 - (17%)
Similarity:173/575 - (30%) Gaps:178/575 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 SEQSDDDDDEDDDDDSESGVRTKVLIKEANDDLSALKVAIKPAAALATAGGVSVNNPGGNKPGQE 609
            |..|..|:|.||:...|.|          |.:.|..||.|:..                      
 Worm    10 SSSSSSDEDSDDEYREEDG----------NSERSNSKVCIEEV---------------------- 42

  Fly   610 NYFESPLGKFFMDIGVGLVQEYVQSDLLRLQKRKMRKAQVQNSKEFEMAINALSGNLQASKTKNA 674
                                |.|:.:.:..:|||                        ..|||: 
 Worm    43 --------------------EEVEKEEIASRKRK------------------------RGKTKD- 62

  Fly   675 PFKFRMKRCEFCNFKSESAMAMANHYETPHMNGVLYKCNFCTFEIRNAT--EIVYHMEAVHNIKA 737
                ....|.||..|......:..|.:....|  .|:|..|:...:..|  |:..| ..:|:.||
 Worm    63 ----EFHPCPFCEKKFRYPNKLREHIKIHDSN--RYQCLECSTITKFGTYGELRAH-HKLHHSKA 120

  Fly   738 RLIKPLPYHQCPNCGFEDNGKAKLARH-------------QPVCAKKFRPELNLAPPNDWEAPAK 789
            .       |:||.|.:.:...|.:.||             ...|.|..:..|.            
 Worm   121 S-------HKCPQCSYTNEKPAFIRRHFEQNHVDGIPCTITGCCIKVAKNRLK------------ 166

  Fly   790 IPRIKPRHGLVGTATAYQAMAAQAAAQKAALANIQQQQAAAQARNNLQAAALAAQNAAKMRQRAP 854
             ..||..|..:..:|  :...::.:..|..|...:..               .:.:..:.:|:..
 Worm   167 -AHIKEYHTSIPLST--EQTRSKLSFNKCPLCEYKPD---------------VSDDDPEQQQKDL 213

  Fly   855 QPPKQNI--VRNPAPVRGGNAMNAGLSLPNSYQLAAGQLVQASKKPMAGQPSI---SITPLPRQS 914
            :...|.|  .|.||....|..:..|....:.:......|:|.........|::   .......::
 Worm   214 EDHVQRIHEEREPALCTLGCGVYLGSGSVSEHLSTCSSLIQNIPSSSQSTPALQNDEWNDANTET 278

  Fly   915 SVGAGAGASSSKAPQAAAGMKPGQSPSGNNKAQFVICEICDGYIKDLEQLRNHMQWMHKVKIHPK 979
            ::....|.||.....:.:.:....|.:.|:..:    ||..|..:...::|.|    .:.::|  
 Worm   279 TLSTITGTSSQFERDSVSEVTNDLSENINDIDE----EIEFGTTEPPNKIRKH----SRSRVH-- 333

  Fly   980 MIYNRPPLNCQKCQFRFFTDQGLERHLLGSHG-----LVTSS------MQEAANKGKDAGRCPVC 1033
                 ...:|:.|...|.....|.:|:...|.     :|.|:      ..:...|.|| |....|
 Worm   334 -----GDFSCEICLKTFTLRDNLRKHVRVYHSENSQKVVKSTGPKHQEQYKCDRKSKD-GDETTC 392

  Fly  1034 GRMYQWKLLNHVSRDH---HMTLKPAHLSYKCTVCTATFGMYKQFETHVYTAHST 1085
            |:.::.:...|   ||   |..:||    |.|..|...|....:|..|:...|.|
 Worm   393 GKTFRTEQALH---DHFNVHDGIKP----YSCHTCNQKFHARDRFAVHLSKYHQT 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEP-1NP_001137875.1 BSP_II <121..>226 CDD:283165
C2H2 Zn finger 951..977 CDD:275371 5/25 (20%)
C2H2 Zn finger 989..1010 CDD:275371 5/20 (25%)
F56D1.1NP_495042.3 C2H2 Zn finger 67..87 CDD:275368 5/19 (26%)
C2H2 Zn finger 94..116 CDD:275368 5/22 (23%)
C2H2 Zn finger 338..359 CDD:275368 5/20 (25%)
C2H2 Zn finger 380..409 CDD:275368 9/32 (28%)
C2H2 Zn finger 417..434 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.