DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEP-1 and ztf-29

DIOPT Version :9

Sequence 1:NP_001137875.1 Gene:MEP-1 / 38327 FlyBaseID:FBgn0035357 Length:1152 Species:Drosophila melanogaster
Sequence 2:NP_499490.1 Gene:ztf-29 / 176585 WormBaseID:WBGene00013438 Length:343 Species:Caenorhabditis elegans


Alignment Length:244 Identity:48/244 - (19%)
Similarity:93/244 - (38%) Gaps:51/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PTTKLASASSSPKQSKPSADDVEQQVTTVEDDEEQVVEEQQEEDVHLPEAPSNEKLELLSAGGKD 79
            |::|....|.:|...       ..|:..:..:.....::||:..|..|..|::...:||:|    
 Worm   136 PSSKAMKTSDTPLTG-------HDQILALLSNLMSAQQQQQQAPVATPTIPASWIDQLLAA---- 189

  Fly    80 ISKEDVAQASPQAPVADEIMEVDGTEDVEENEVENDDEDSQITSSSSKEPKLDEEDEEATTNGDG 144
                 .....|..|.:........:.::|:.. |....|:.:||      .::..:|.|:|:|:.
 Worm   190 -----TPALLPFMPSSSTFSASSSSSEMEQTP-EPSSLDTVLTS------MMNNNEEAASTSGEI 242

  Fly   145 DHEPEDEDDAQ-KIGSTAENSCEAEDPLGA--VTVPDDELASGKKAHLDGEESVASEGVVEEEPP 206
            ..|.|:|::.. .||...:....|   :||  ::|..::..|         .|::||..:...|.
 Worm   243 KEEEEEEEEVDIDIGDEKDLLVRA---VGADFLSVKTEQPIS---------NSMSSESGIGSAPV 295

  Fly   207 AKQENGFGASPNQKENGQASIAEARAAIAPSDGGVVNLDEDSDEEMEDI 255
            :...:....||.:||...             |.|.|..::.|...::||
 Worm   296 SNTPSPVATSPERKEENM-------------DVGRVKKEKKSKRSIDDI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEP-1NP_001137875.1 BSP_II <121..>226 CDD:283165 24/107 (22%)
C2H2 Zn finger 951..977 CDD:275371
C2H2 Zn finger 989..1010 CDD:275371
ztf-29NP_499490.1 COG5236 <15..>92 CDD:227561
C2H2 Zn finger 20..40 CDD:275368
C2H2 Zn finger 47..68 CDD:275368
C2H2 Zn finger 76..92 CDD:275368
U2AF_lg 112..>191 CDD:273727 13/70 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.