DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEP-1 and si:ch211-202h22.10

DIOPT Version :9

Sequence 1:NP_001137875.1 Gene:MEP-1 / 38327 FlyBaseID:FBgn0035357 Length:1152 Species:Drosophila melanogaster
Sequence 2:XP_017212100.2 Gene:si:ch211-202h22.10 / 100002322 ZFINID:ZDB-GENE-110914-121 Length:519 Species:Danio rerio


Alignment Length:445 Identity:90/445 - (20%)
Similarity:142/445 - (31%) Gaps:108/445 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 TKNAPFKFRMKRCEFCNFKSESAMAMANHYETPHMNGVLYKCNFCTFEIRNATEIVYHMEAVHNI 735
            |:..||     .|..|. |..||......:...|.....:.|..|........:|..||. :|..
Zfish     5 TEEKPF-----ICPECG-KCFSAKQKLETHIRIHTGEKPFSCPQCGKGFTQQGQIKTHMR-IHTG 62

  Fly   736 KARLIKPLPYHQCPNCGFEDNGKAKLARHQ-----------PVCAKKFRPELNLAPPNDWEAPAK 789
            :    ||.   .||.|......|..|..|.           |.|...|               ::
Zfish    63 E----KPF---TCPQCDKSVTSKQSLKSHMRIHTGEKPFTCPECGMIF---------------SQ 105

  Fly   790 IPRIKPRHGLVGTATAYQAMAAQAAAQKAALANIQQQQAAAQARNNLQAAALAAQNAAK---MRQ 851
            :..:| ||  |.|.|..:..:.....::..:    :|...:..|.:......|.....|   .:|
Zfish   106 LGYLK-RH--VRTHTGLKPFSCTQCGKRYKV----KQSLESHMRVHTGEKPFACPQCGKGFTAKQ 163

  Fly   852 RAPQPPKQNIVRNPAPVRGGNAMNAGLSLPNSYQLAAGQLVQASKKPMAGQPSISITPLPRQSSV 916
            ........:|...|.     |.....:|..:...|....|:...:||.          :.||   
Zfish   164 CLKSHMSVHIEEKPF-----NCSLCEMSFTHQQSLKRHMLIHVGEKPY----------VCRQ--- 210

  Fly   917 GAGAGASSSKAPQAAAGMKPGQSPSGNNKAQFVICEICDGY-IKDLEQLRNHMQWMHKVKIHPKM 980
             .|...|..::.::...:..|:.|       |...|...|: :|  :.|.:||:....||     
Zfish   211 -CGKSFSVKQSLESHIRIHTGEKP-------FACAECGKGFAVK--QNLESHMRVHTGVK----- 260

  Fly   981 IYNRPPLNCQKCQFRFFTDQGLERHLLGSHG--LVTSSMQEAA-------------NKGKDAGRC 1030
                 |.:|.:|..||...|.||.|:....|  ..|.||.:..             :.|:....|
Zfish   261 -----PFSCPQCGKRFTVKQSLESHMTIHTGERPFTCSMCDKTFTVKHKLEYHMRNHTGEKPYIC 320

  Fly  1031 PVCGRMYQWKLLNHVSRDHHMTLKPAHLSYKCTVCTATFGMYKQFETHVYTAHST 1085
            |.||..|  .|.||:.|  |:.:......:.|:.|...|.|.:..::|:...:.|
Zfish   321 PQCGNSY--ALRNHLER--HVRIHTGEKPFSCSKCAKRFTMKQSLKSHMRVHNRT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEP-1NP_001137875.1 BSP_II <121..>226 CDD:283165
C2H2 Zn finger 951..977 CDD:275371 8/26 (31%)
C2H2 Zn finger 989..1010 CDD:275371 8/20 (40%)
si:ch211-202h22.10XP_017212100.2 C2H2 Zn finger 12..32 CDD:275368 5/20 (25%)
COG5048 36..439 CDD:227381 81/408 (20%)
C2H2 Zn finger 40..60 CDD:275368 5/20 (25%)
C2H2 Zn finger 68..88 CDD:275368 6/19 (32%)
C2H2 Zn finger 96..116 CDD:275368 7/37 (19%)
C2H2 Zn finger 124..144 CDD:275368 2/23 (9%)
C2H2 Zn finger 152..172 CDD:275368 2/19 (11%)
C2H2 Zn finger 180..200 CDD:275368 3/19 (16%)
C2H2 Zn finger 208..228 CDD:275368 4/23 (17%)
C2H2 Zn finger 236..256 CDD:275368 6/21 (29%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
C2H2 Zn finger 292..312 CDD:275368 2/19 (11%)
C2H2 Zn finger 320..340 CDD:275368 10/23 (43%)
C2H2 Zn finger 348..368 CDD:275368 5/19 (26%)
C2H2 Zn finger 376..396 CDD:275368
C2H2 Zn finger 404..424 CDD:275368
C2H2 Zn finger 432..452 CDD:275368
zf-H2C2_2 448..469 CDD:316026
C2H2 Zn finger 460..480 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.