DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and dpr21

DIOPT Version :9

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:195 Identity:45/195 - (23%)
Similarity:72/195 - (36%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 NCGVYSL------WRRWHLDVQRQLVSISLTCAAPQMLQNQGFSSL-----GEHHFKCAKPQF-- 238
            ||.:.:|      |.| |.|:.      .||.:......:|.|:|:     |:...:...||.  
  Fly    72 NCRIKNLGNKTVSWIR-HRDLH------LLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRD 129

  Fly   239 ---------------------LVAP-------QDAQVAAGEQVELSCEVTGLPRPQIT--WMHNT 273
                                 :|.|       .:..:..|..|.|:|.:..||.|.|:  |.||.
  Fly   130 SGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNN 194

  Fly   274 QEL-------GLEEQAQAEILPSGSLLIRSADTSDMGIYQCIARNEMGALRSQPVRLVVNGGNHP 331
            ||:       |:....:...:.:..|||:.|..:|.|.|.|:..|    ..|:.|.:.:..|:||
  Fly   195 QEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN----ANSKSVNVHILKGDHP 255

  Fly   332  331
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845 27/100 (27%)
IG_like 242..325 CDD:214653 26/98 (27%)
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352
Ig 570..643 CDD:299845
An_peroxidase 777..1317 CDD:281139
peroxidasin_like 898..1338 CDD:188658
VWC 1465..1523 CDD:278520
dpr21NP_001163838.2 Ig 71..149 CDD:299845 15/83 (18%)
IG_like 71..140 CDD:214653 15/74 (20%)
IG_like 162..249 CDD:214653 25/90 (28%)
IGc2 169..242 CDD:197706 23/76 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.