DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and Cybb

DIOPT Version :9

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_076455.1 Gene:Cybb / 66021 RGDID:620574 Length:570 Species:Rattus norvegicus


Alignment Length:626 Identity:110/626 - (17%)
Similarity:190/626 - (30%) Gaps:225/626 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1009 GDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVG-------AQMQHITF 1066
            |:..|||.:.:..: .:|:..:..:..|..::   :|.:..|...||::|       |....:.|
  Rat     2 GNWAVNEGLSIFVI-LVWLGLNVFLFVKYYKV---YDDEPKYNYTRKLLGSALALARAPAACLNF 62

  Fly  1067 KQWLPLIIGESGMEMMGEYQGYNP--------QLNPSIANEFATAALRFGHTIINPILHRLN--- 1120
            .  ..||:......::...:|.:.        ||:.::......|.:...||.|:.|.|..|   
  Rat    63 N--CMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHLFNVEW 125

  Fly  1121 ------ETFQPI-------------------------PQGHLLLHKAFFAPWRLAYEGGVDPLMR 1154
                  .|..|.                         |:|.|     :.|..|||...|:...:.
  Rat   126 CVNARVGTSDPYSVALSNIGDKENEEYLNFAREKIKNPEGGL-----YVAVTRLAGITGIVITLC 185

  Fly  1155 GFLAVPAKLKTPDQNLNTELTEKLFQTAHAVA---LDLA---AINIQRG------RDHGMPGYNV 1207
            ..|.:.:..||    :.....|..:.|.|...   :.||   |..|.||      ::|       
  Rat   186 LILIITSSTKT----IRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTSDSLKEH------- 239

  Fly  1208 YRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCL-- 1270
                 ||.|..|.....|:|....:    .:..|:|.....|:            |||:|..|  
  Rat   240 -----NLDVCADKIKEWGKIKECPV----PKFAGNPPMTWKWI------------VGPMFLYLCE 283

  Fly  1271 -LVEQFR---------------------------RLRDGDRLYYENPGV----FSPEQLTQIKQA 1303
             ||..:|                           |:..|..::.:.|.|    :.|..||...:.
  Rat   284 RLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFRMEVGQYIFVKRPAVSKLEWHPFTLTSAPEE 348

  Fly  1304 NFG----RVL------------CD--------------VGDNFDQVTENVF----ILAKHQG--- 1331
            :|.    |::            ||              |...|...:|:||    ::....|   
  Rat   349 DFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGV 413

  Fly  1332 ----------GYKKCEDIIGINL----YLWQECGRCNSPPAI--FDSYIPQTYTKRSNRQKRDLG 1380
                      .||.|::...:.|    :.|    .|....|.  |...:....|:...|...:..
  Rat   414 TPSASILKSVWYKYCDNATSLRLKKIYFYW----LCRDTHAFEWFADLLQLLETQMQERNNANFL 474

  Fly  1381 KENDEV-ATAESYDSPLESLYDVNEERVSGLEE--LIG--SFQKELKKLHKKLRKLEDSCNSADS 1440
            ..|..: ...||..:.....:|..::.::||::  |.|  ::..|.|.:             |..
  Rat   475 SYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTI-------------ASQ 526

  Fly  1441 EPVAQVVQLAAAPPQLV------------SKPKRSHCVDDK 1469
            .|..::......|..|.            |.|:..|.:.:|
  Rat   527 HPNTRIGVFLCGPEALAKTLSKQSISNSESGPRGVHFIFNK 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845
IG_like 242..325 CDD:214653
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352
Ig 570..643 CDD:299845
An_peroxidase 777..1317 CDD:281139 77/432 (18%)
peroxidasin_like 898..1338 CDD:188658 85/470 (18%)
VWC 1465..1523 CDD:278520 1/5 (20%)
CybbNP_076455.1 Ferric_reduct 65..219 CDD:280043 28/162 (17%)
NOX_Duox_like_FAD_NADP 297..570 CDD:99783 45/288 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.