| Sequence 1: | NP_523891.2 | Gene: | Pxn / 38326 | FlyBaseID: | FBgn0011828 | Length: | 1527 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001688066.1 | Gene: | APL1A / 5666905 | VectorBaseID: | AGAP007036 | Length: | 428 | Species: | Anopheles gambiae |
| Alignment Length: | 203 | Identity: | 51/203 - (25%) |
|---|---|---|---|
| Similarity: | 92/203 - (45%) | Gaps: | 29/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 CLERTVR--CIRAKLSAVPKLPQDTQTLDLRF-----------------NHIEELPANAFSGLAQ 77
Fly 78 LTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAG 142
Fly 143 LFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSLWRRWHLDVQRQLVS 207
Fly 208 ISLTCAAP 215 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pxn | NP_523891.2 | LRR_RI | 51..>161 | CDD:238064 | 35/126 (28%) |
| leucine-rich repeat | 54..77 | CDD:275380 | 6/39 (15%) | ||
| LRR_8 | 55..112 | CDD:290566 | 13/73 (18%) | ||
| leucine-rich repeat | 78..101 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 102..125 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 124..184 | CDD:290566 | 23/59 (39%) | ||
| leucine-rich repeat | 126..149 | CDD:275380 | 10/22 (45%) | ||
| LRR_4 | 148..185 | CDD:289563 | 12/36 (33%) | ||
| leucine-rich repeat | 150..173 | CDD:275380 | 7/22 (32%) | ||
| Ig | 240..325 | CDD:299845 | |||
| IG_like | 242..325 | CDD:214653 | |||
| I-set | 366..450 | CDD:254352 | |||
| Ig | 384..451 | CDD:143165 | |||
| I-set | 458..546 | CDD:254352 | |||
| Ig | 472..536 | CDD:299845 | |||
| I-set | 553..644 | CDD:254352 | |||
| Ig | 570..643 | CDD:299845 | |||
| An_peroxidase | 777..1317 | CDD:281139 | |||
| peroxidasin_like | 898..1338 | CDD:188658 | |||
| VWC | 1465..1523 | CDD:278520 | |||
| APL1A | XP_001688066.1 | LRR_8 | 112..172 | CDD:290566 | 16/59 (27%) |
| leucine-rich repeat | 114..137 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | 160..402 | CDD:238064 | 30/92 (33%) | ||
| LRR_8 | 160..220 | CDD:290566 | 23/59 (39%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 4/20 (20%) | ||
| leucine-rich repeat | 231..255 | CDD:275380 | 7/20 (35%) | ||
| LRR_8 | 270..327 | CDD:290566 | |||
| leucine-rich repeat | 271..292 | CDD:275380 | |||
| leucine-rich repeat | 293..316 | CDD:275380 | |||
| LRR_8 | 316..373 | CDD:290566 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||