DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and bgna

DIOPT Version :9

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_001002227.1 Gene:bgna / 431774 ZFINID:ZDB-GENE-040704-74 Length:369 Species:Danio rerio


Alignment Length:295 Identity:69/295 - (23%)
Similarity:115/295 - (38%) Gaps:92/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CPAGCTCLERTVRCIRAKLSAVP-KLPQDTQTLDLRFNHIEELPANAFSGLAQLTTLFLNDNELA 89
            ||.||.|..|.|:|....|..|| .:|.||..|||:.|.|.|:....|.||:.|..|.|..|:::
Zfish    64 CPFGCRCELRVVQCSDLGLGYVPYDIPADTLLLDLQSNRITEIREGDFKGLSNLYALVLRYNQIS 128

  Fly    90 YLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLI 154
            .:...|...|..|:.:|:::|.|:.:|.                    .||:.|.:       |.
Zfish   129 KIHPKAFLPLKRLQKLYISHNLLTSMPK--------------------NLPSSLVE-------LR 166

  Fly   155 MYNNKLTQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSLWRRWHLDVQRQLVSISLTCAAPQMLQ 219
            :::|::.::|...|:.|:|:..:.:..|.                                  ||
Zfish   167 IHDNRIKKVPAFSFSGLHNMHVIEMGRNP----------------------------------LQ 197

  Fly   220 NQGFS-----SLGEHHFKCAKPQFLVAPQDA------------QVAAGEQVELS----CEVTGLP 263
            |.||.     .|..::.:.::.:....|:|.            |:.|.|.|:||    .:..||.
Zfish   198 NSGFEPGAFMGLKLNYLRISEAKLTGVPKDLPGSLHELHLDNNQIQAIELVDLSQYTQLQRLGLG 262

  Fly   264 RPQI--------TWMHNTQELGLEEQAQAEILPSG 290
            ..||        :::.|.:||.|:......: |||
Zfish   263 SNQIRHIEHGALSYLTNLRELHLDNNRLPSV-PSG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064 28/109 (26%)
leucine-rich repeat 54..77 CDD:275380 10/22 (45%)
LRR_8 55..112 CDD:290566 18/56 (32%)
leucine-rich repeat 78..101 CDD:275380 6/22 (27%)
leucine-rich repeat 102..125 CDD:275380 5/22 (23%)
LRR_8 124..184 CDD:290566 10/59 (17%)
leucine-rich repeat 126..149 CDD:275380 3/22 (14%)
LRR_4 148..185 CDD:289563 7/36 (19%)
leucine-rich repeat 150..173 CDD:275380 5/22 (23%)
Ig 240..325 CDD:299845 19/75 (25%)
IG_like 242..325 CDD:214653 19/73 (26%)
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352
Ig 570..643 CDD:299845
An_peroxidase 777..1317 CDD:281139
peroxidasin_like 898..1338 CDD:188658
VWC 1465..1523 CDD:278520
bgnaNP_001002227.1 LRRNT 64..93 CDD:214470 12/28 (43%)
leucine-rich repeat 72..92 CDD:275380 7/19 (37%)
leucine-rich repeat 93..116 CDD:275380 10/22 (45%)
LRR_RI 94..>323 CDD:238064 55/265 (21%)
LRR_8 96..151 CDD:290566 18/54 (33%)
leucine-rich repeat 117..140 CDD:275380 6/22 (27%)
leucine-rich repeat 141..161 CDD:275380 7/39 (18%)
LRR_8 160..217 CDD:290566 14/97 (14%)
leucine-rich repeat 162..185 CDD:275380 6/29 (21%)
leucine-rich repeat 186..209 CDD:275380 6/56 (11%)
leucine-rich repeat 211..231 CDD:275380 2/19 (11%)
LRR_8 231..290 CDD:290566 14/58 (24%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
leucine-rich repeat 256..279 CDD:275380 4/22 (18%)
LRR_8 278..343 CDD:290566 7/20 (35%)
leucine-rich repeat 303..330 CDD:275380
leucine-rich repeat 331..356 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.