DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and cd

DIOPT Version :9

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_651081.1 Gene:cd / 42681 FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster


Alignment Length:793 Identity:255/793 - (32%)
Similarity:389/793 - (49%) Gaps:133/793 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 YQISGAGSLFVKNVTIPDGGRYECQLK-----NQFGRASASALVTIRNNVDLAPGDRYVRIAFAE 663
            :.::|:.|....|..:||....|..|:     :..|..:.||.:.       |.|||.:      
  Fly    84 FVVNGSDSELAPNRPLPDEPAAEWALQQAALGHHDGAQAVSAGIK-------ALGDREI------ 135

  Fly   664 AAKEIDLAINNTLDMLFSN-RSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLVNIRKHVQ 727
              .|..|..|......|.: ||....|              |||:|||...:..:..::|.|   
  Fly   136 --LEEGLQPNEVNTPSFRHYRSLSTNP--------------EARKLARRGYVENQATIDIAK--- 181

  Fly   728 EGDNLTMKSEEYEFRDLLSREHLHLVAELSGCMEHREMPNCTDM---C-FHSRYRSIDGTCNNLQ 788
                      .:.:.....|.::       |......:|:.|.:   | |::|||...|.|||.|
  Fly   182 ----------RFNYTKQPGRSNI-------GWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQ 229

  Fly   789 HP-TWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAK-PSARLVSTSLVATKEITPDARIT 851
            || |:|||:..:||:..|.|.:|.:.|       ..|.|.: |.||.||..:..:...| |:..|
  Fly   230 HPRTYGASMVPYRRMVSPDYADGIAAP-------RVSHHGRLPPARQVSLKIHRSSYET-DSNFT 286

  Fly   852 HMVMQWGQFLDHDLDHAIPSVSSESWDGIDCKKSC-----EMAPPCYPIEVPPNDPRVR--NRRC 909
            .|:..:|||:|||:. |....:|:..:.|||   |     |..|.|||:::.|:||..:  |..|
  Fly   287 VMLAVFGQFMDHDIT-ATSLTTSQEGESIDC---CVAATREQHPECYPVDILPDDPYYKQYNISC 347

  Fly   910 IDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGV 974
            ::.|||:    ...|..|    ..|.|:||.|::||||.|||.......:||:..:  |.||:.|
  Fly   348 MNFVRSA----PAPTGRF----GPRMQLNQATAFIDASVVYGNLEQRQNQLRSFIN--GSLRMFV 402

  Fly   975 HFPRQKDMLPFAA-PQDGMDCRR-NLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKL 1037
             ....:.:||.:: |.||  |.| .:......||.|||.|.||.:.|.:||.:|.|.||.:|.:|
  Fly   403 -TDDGRQLLPISSNPADG--CNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQL 464

  Fly  1038 KQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEYQG---------YNPQLN 1093
            ::.|.||:.:.||||||||:||||.|||:.::||:::|::..|..|....         |:|:::
  Fly   465 QEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVD 529

  Fly  1094 PSIANEFATAALRFGHTIINPI--LHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGF 1156
            |||||.||.||.||.||::..:  :.|.|.|.:.|.     |||..|.|:.|..|.|:|.     
  Fly   530 PSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIE-----LHKMLFNPFSLWAEHGIDH----- 584

  Fly  1157 LAVPAKLKTP----DQNLNTELTEKLFQ-TAH----AVALDLAAINIQRGRDHGMPGYNVYRKLC 1212
             |:.....||    |:..:.|:|:|||: ||.    ...|||.::|||||||||:|.|.|:|:.|
  Fly   585 -ALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHC 648

  Fly  1213 NLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRR 1277
            .|.....:|:::..|.:|.: ..::::|..|.:|||:.|.:.|..::|...|||..|::.:||.|
  Fly   649 RLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLR 712

  Fly  1278 LRDGDRLYYE---NPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGG-YKKCED 1338
            |:.||..:||   .|..|:..||.:|.:.:...::|...|...:|.|:|....:..|. :..|:|
  Fly   713 LKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQD 777

  Fly  1339 IIG--INLYLWQE 1349
            :.|  .|...|.|
  Fly   778 LEGFHFNFEPWSE 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845
IG_like 242..325 CDD:214653
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352 10/44 (23%)
Ig 570..643 CDD:299845 10/43 (23%)
An_peroxidase 777..1317 CDD:281139 209/573 (36%)
peroxidasin_like 898..1338 CDD:188658 167/467 (36%)
VWC 1465..1523 CDD:278520
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 209/573 (36%)
peroxinectin_like 364..750 CDD:188655 151/402 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I2172
eggNOG 1 0.900 - - E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11475
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.