DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and Lrrc26

DIOPT Version :9

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_001014075.1 Gene:Lrrc26 / 311803 RGDID:1308398 Length:334 Species:Rattus norvegicus


Alignment Length:287 Identity:80/287 - (27%)
Similarity:109/287 - (37%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLLGLLLLLAG----------GVQ------SVYCPAGCTCLE-RTVRCIRAKLSAVPK-LPQDT 54
            |.||.|||||..          |..      :..||..|:|.. ....|....|.|||. |....
  Rat    13 LSLLLLLLLLLSWRRVWTQEHIGTDPSKSPVAPVCPEACSCSPGGKANCSALALPAVPAGLSWQV 77

  Fly    55 QTLDLRFNHIEELP------------------------ANAFSGLAQLTTLFLNDNELAYLQDGA 95
            ::|.|..|.:..||                        |.||.||..|..|.|:.|:|..|..|.
  Rat    78 RSLLLDRNRVSTLPPGAFADAGALLYLVLRENRLRSVHARAFWGLGVLQRLDLSSNQLETLSPGT 142

  Fly    96 LNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKL 160
            ...|.||.|:.|..|||:.|..:|...:|.|..:.|::|.:..|.|||.::||.|:         
  Rat   143 FTPLRALSFLSLAGNRLALLEPSILGPLPLLRVLSLQDNSLSALEAGLLNSLPALD--------- 198

  Fly   161 TQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSL--WRRWHLDVQRQLVSISLTCAAPQMLQNQGF 223
                           .|||.||...|:|.:..|  |.|.|.....:  :.:|.|.:|::......
  Rat   199 ---------------VLRLHGNPWACSCALRPLCTWLRKHPRPTSE--TETLLCVSPKLQTLNLL 246

  Fly   224 SSLGEHHFK-CAKPQFLVAPQDAQVAA 249
            :...::.|| |.  |.|.|...|.|.|
  Rat   247 TDFPDNAFKQCT--QSLAARDLAVVYA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064 38/133 (29%)
leucine-rich repeat 54..77 CDD:275380 10/46 (22%)
LRR_8 55..112 CDD:290566 23/80 (29%)
leucine-rich repeat 78..101 CDD:275380 8/22 (36%)
leucine-rich repeat 102..125 CDD:275380 8/22 (36%)
LRR_8 124..184 CDD:290566 16/59 (27%)
leucine-rich repeat 126..149 CDD:275380 8/22 (36%)
LRR_4 148..185 CDD:289563 7/36 (19%)
leucine-rich repeat 150..173 CDD:275380 1/22 (5%)
Ig 240..325 CDD:299845 4/10 (40%)
IG_like 242..325 CDD:214653 3/8 (38%)
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352
Ig 570..643 CDD:299845
An_peroxidase 777..1317 CDD:281139
peroxidasin_like 898..1338 CDD:188658
VWC 1465..1523 CDD:278520
Lrrc26NP_001014075.1 LRR_8 76..135 CDD:290566 14/58 (24%)
LRR 1 76..97 5/20 (25%)
leucine-rich repeat 77..100 CDD:275380 5/22 (23%)
LRR 2 100..121 3/20 (15%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 3 124..145 7/20 (35%)
LRR_8 125..183 CDD:290566 21/57 (37%)
LRR_4 125..164 CDD:289563 16/38 (42%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR 4 148..169 9/20 (45%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
LRR 5 172..194 7/21 (33%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
leucine-rich repeat 197..239 CDD:275380 14/67 (21%)
TPKR_C2 205..258 CDD:301599 12/54 (22%)
leucine-rich repeat 240..259 CDD:275380 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.