| Sequence 1: | NP_523891.2 | Gene: | Pxn / 38326 | FlyBaseID: | FBgn0011828 | Length: | 1527 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036057.1 | Gene: | Ceacam9 / 26368 | MGIID: | 1347247 | Length: | 234 | Species: | Mus musculus |
| Alignment Length: | 241 | Identity: | 52/241 - (21%) |
|---|---|---|---|
| Similarity: | 78/241 - (32%) | Gaps: | 74/241 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 238 FLVAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQA-------------------- 282
Fly 283 ---QAEILP----------SGSLLIRSADTSDMGIYQCIARNEMGALRSQPVRLVVNGGNHPLDS 334
Fly 335 PIDARSNQVWADAGTPMHGATPLPSPLPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQ 399
Fly 400 WFVNGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGS 445 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pxn | NP_523891.2 | LRR_RI | 51..>161 | CDD:238064 | |
| leucine-rich repeat | 54..77 | CDD:275380 | |||
| LRR_8 | 55..112 | CDD:290566 | |||
| leucine-rich repeat | 78..101 | CDD:275380 | |||
| leucine-rich repeat | 102..125 | CDD:275380 | |||
| LRR_8 | 124..184 | CDD:290566 | |||
| leucine-rich repeat | 126..149 | CDD:275380 | |||
| LRR_4 | 148..185 | CDD:289563 | |||
| leucine-rich repeat | 150..173 | CDD:275380 | |||
| Ig | 240..325 | CDD:299845 | 25/117 (21%) | ||
| IG_like | 242..325 | CDD:214653 | 25/115 (22%) | ||
| I-set | 366..450 | CDD:254352 | 20/80 (25%) | ||
| Ig | 384..451 | CDD:143165 | 18/62 (29%) | ||
| I-set | 458..546 | CDD:254352 | |||
| Ig | 472..536 | CDD:299845 | |||
| I-set | 553..644 | CDD:254352 | |||
| Ig | 570..643 | CDD:299845 | |||
| An_peroxidase | 777..1317 | CDD:281139 | |||
| peroxidasin_like | 898..1338 | CDD:188658 | |||
| VWC | 1465..1523 | CDD:278520 | |||
| Ceacam9 | NP_036057.1 | Ig_CEACAM_D1 | 35..139 | CDD:143251 | 22/106 (21%) |
| IG_like | <86..139 | CDD:214653 | 15/52 (29%) | ||
| IG_like | 152..219 | CDD:214653 | 19/95 (20%) | ||
| IGc2 | 159..220 | CDD:197706 | 18/61 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||