DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and ptgs1

DIOPT Version :9

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_705942.1 Gene:ptgs1 / 246226 ZFINID:ZDB-GENE-020530-1 Length:597 Species:Danio rerio


Alignment Length:567 Identity:117/567 - (20%)
Similarity:190/567 - (33%) Gaps:200/567 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 RDLLSREHLHLVAELSGCMEHREMPNCTDMCFHSRYRSIDGTCNNLQHPTWGA--SLTAFRRLAP 804
            ||.|.|:.|.:.|.|        :|  :...::|||          .:..|.|  ::|.:.|:.|
Zfish   109 RDWLMRKVLTVRANL--------IP--SPPTYNSRY----------DYLNWEAYSNITYYTRILP 153

  Fly   805 PIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQ-WGQFLDHDLDHA 868
            |: .|....|:| |||.:    ..|..:|:....:..:....|.:.|:::.. :.|...|...  
Zfish   154 PV-PNDCPTPMG-TKGKI----KLPDPKLLVEKFMLRRNFRLDPQGTNLMFAFFAQHFTHQFF-- 210

  Fly   869 IPSVSSESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQH 933
                                              :..||           .|.|.|         
Zfish   211 ----------------------------------KTHNR-----------VGLGFT--------- 221

  Fly   934 REQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGV-----------HFPRQKDMLPFAA 987
                ..|...:||..:||.|.....|||  ..::|.|:..|           |...:....|...
Zfish   222 ----KGLGHGVDAGHIYGDSLDRQLELR--LHKDGKLKYQVLNGDIYPPTVLHAQVKMSYPPSVP 280

  Fly   988 PQDGMDCRRNLDENTMSCFVSGDIRVNEQV-----GLLAMHTIWMREHNRIASKLKQINSHWDGD 1047
            |:.                   .:.:.::|     ||....|:|:|||||:...|||.:..|..:
Zfish   281 PEQ-------------------QLAIGQEVFGLLPGLGMYATLWLREHNRVCEILKQEHPTWGDE 326

  Fly  1048 TLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEY----QGYNPQLNPSIANEFATAALRFG 1108
            .|:|.||.|                ||||:...::.||    .||..:|:               
Zfish   327 QLFQTARLI----------------IIGETIRIVIEEYVQHLSGYRLKLH--------------- 360

  Fly  1109 HTIINPIL---------HRLNETFQPIPQGHLLLHKAFFAPW-RLAYEG-----------GVDPL 1152
               .:|.|         :|::..|..:...|.|:..:|:... .:.|..           |::.|
Zfish   361 ---FDPTLLFNSQFQYQNRISVEFNQLYHWHPLMPDSFYIDGDHIQYSKFIFNTSILTHYGLEKL 422

  Fly  1153 MRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVA 1217
            :..|...||.......|:            |.|...:|...|...|:..:..:|.|||..||...
Zfish   423 VEAFSIQPAGQIGGGHNI------------HPVVSGVAERVIVESRELRLQPFNEYRKRFNLKPY 475

  Fly  1218 QDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVG 1264
            ..|.:|.||   .|:.::::|||||.|.::.:...:||....|...|
Zfish   476 TSFAELTGE---QEMSKELEELYGHIDAMEFYPALLLEKTRPGAVFG 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845
IG_like 242..325 CDD:214653
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352
Ig 570..643 CDD:299845
An_peroxidase 777..1317 CDD:281139 107/532 (20%)
peroxidasin_like 898..1338 CDD:188658 88/408 (22%)
VWC 1465..1523 CDD:278520
ptgs1NP_705942.1 EGF 36..68 CDD:278437
prostaglandin_endoperoxide_synthase 90..576 CDD:188648 117/567 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.