DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and Igsf9b

DIOPT Version :9

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:488 Identity:114/488 - (23%)
Similarity:187/488 - (38%) Gaps:91/488 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 AKPQFL-VAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSA 297
            |.|.|. ..||..:...|..:.::|...|.|:|.:||:.....||...:.|   :..|||.:.|.
Mouse   139 APPTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLLGASAKYQ---VSDGSLTVTSV 200

  Fly   298 DTSDMGIYQCIARNEMG-ALRSQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSPL 361
            ...|.|.|.|.|.:..| |:.:  ..|:|.|                              |..:
Mouse   201 SREDRGAYTCRAYSIQGEAVHT--THLLVQG------------------------------PPFI 233

  Fly   362 PSPPHFTHQPHDQIVALHGSGHVLLDCAASGWP---------QPDIQWFVNGRQLLQSTPSLQLQ 417
            .|||        :.:.::.|...||.|.|..:|         |.:..:|.|..:|     .:::.
Mouse   234 VSPP--------ENITVNISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKL-----RVRIL 285

  Fly   418 ANGSLILLQPNQLSAGTYRCEARNSLG-SVQATARIELKELPEILTAPQSQTIKLGKAFVLECDA 481
            .:|:||:.:.....||.|.|...|||| |..|:|.:.::....:|..|....:.:|....:.|..
Mouse   286 IDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPV 350

  Fly   482 DGNPLPT-IDWQLNGVPLPGNTPDLQLEN-------ENTELVVGAARQEHAGVYRCTAHNENGET 538
            |..|..| :.|..:|.|       ||:|.       |:..:.:..|.:|..|.|.|..:|..|..
Mouse   351 DAEPPATVVKWNKDGRP-------LQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTM 408

  Fly   539 SVEATIKVERSQSPPQLAIEPS-NLVAITGTTIELPCQADQPEDGLQISWRHDGRLIDPNVQLAE 602
            ...|..::. .:.||...:.|. ......|..:.:||.| ..:....|:||..|:   |:   ..
Mouse   409 GQSAPARLV-LKDPPYFTVLPGWEYRQEAGRELLIPCAA-AGDPFPVITWRKVGK---PS---RS 465

  Fly   603 KYQISGAGSLFVKNVTIPDGGRYECQLKNQFGRASASALVTIRNNVDLAPGDRYVRIAFAEAAKE 667
            |:....:|||..:.::..|.|.:||...|.....:||..:|:......|||...|.::...|...
Mouse   466 KHNALPSGSLQFRALSKEDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVHVSMTTANVS 530

  Fly   668 IDLAINNTLDMLFSNRSDKAPPNYGELLRVFRF 700
            .:...:...:..||       ..||.|::..:|
Mouse   531 WEPGYDGGYEQTFS-------VWYGPLMKRAQF 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845 24/85 (28%)
IG_like 242..325 CDD:214653 24/83 (29%)
I-set 366..450 CDD:254352 23/93 (25%)
Ig 384..451 CDD:143165 22/76 (29%)
I-set 458..546 CDD:254352 22/95 (23%)
Ig 472..536 CDD:299845 18/71 (25%)
I-set 553..644 CDD:254352 22/91 (24%)
Ig 570..643 CDD:299845 19/72 (26%)
An_peroxidase 777..1317 CDD:281139
peroxidasin_like 898..1338 CDD:188658
VWC 1465..1523 CDD:278520
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462 26/90 (29%)
Ig 231..323 CDD:386229 27/104 (26%)
Ig <355..416 CDD:386229 16/67 (24%)
Ig 440..504 CDD:319273 19/70 (27%)
FN3 512..607 CDD:238020 11/52 (21%)
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.