DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and AT3G16175

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_566538.1 Gene:AT3G16175 / 820863 AraportID:AT3G16175 Length:157 Species:Arabidopsis thaliana


Alignment Length:127 Identity:36/127 - (28%)
Similarity:60/127 - (47%) Gaps:7/127 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HITEII--NKSTGFESHLQK-VKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYA 74
            ::.||.  |..|.||..:.| ::::..|.|....:|.|....|......:.|.|..::|.|...|
plant    12 YLEEIAKGNGQTEFEILILKGLELIHVGKGILRCKLLVTDHVVGEDGSWNAGVITAVMDSIGASA 76

  Fly    75 LMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQA--NLSKVGKYLAFIDCTLKHKKDDLVIAKG 134
            :.|......:||||:.:|.:.||:.:.|.|:|  |.|..|...|.|:  ::.:....:||.|
plant    77 VYSSGGGLHISVDLNSSFYSTAKIHETVEIEARVNGSNGGLKSAVIE--IRRETSGEIIATG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 29/106 (27%)
AT3G16175NP_566538.1 PaaI_thioesterase 32..141 CDD:239527 29/107 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21660
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.