DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and AT2G29590

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_565683.1 Gene:AT2G29590 / 817508 AraportID:AT2G29590 Length:158 Species:Arabidopsis thaliana


Alignment Length:134 Identity:37/134 - (27%)
Similarity:65/134 - (48%) Gaps:14/134 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AKHITEIINKSTGFESHLQ----KVKIVDGGDGACTAELKV---DQDHVNLYKFLHGGYIMTLVD 68
            |..:.|.:.:...|..:..    :|..|:.|..:|:.::.:   |:|     |.|..|.|..|||
plant    21 APRVEEFLGEGKSFYENFSLRGIRVNRVEPGFISCSFKVPLRLTDRD-----KNLANGAIANLVD 80

  Fly    69 LITTYALMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQAN-LSKVGKYLAFIDCTLKHKKDDLVIA 132
            .:....:..:.....||||:|:.||:.||||:::.|.:. |.:.|.|...| ..:::|....:||
plant    81 EVGGALVHGEGLPMSVSVDMSIAFLSKAKLGEELEITSRLLGERGGYKGTI-VVVRNKMTGEIIA 144

  Fly   133 KGTH 136
            :|.|
plant   145 EGRH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 34/110 (31%)
AT2G29590NP_565683.1 PaaI_thioesterase 42..151 CDD:239527 34/113 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21660
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.