DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and AT1G52191

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001117468.1 Gene:AT1G52191 / 6241250 AraportID:AT1G52191 Length:138 Species:Arabidopsis thaliana


Alignment Length:113 Identity:30/113 - (26%)
Similarity:57/113 - (50%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSK-PCHPGVSVDLSVN 91
            |:.::::..|.|....:|.|....:|....||...|..|::|:...|:.|. ..|  .||||:.:
plant     6 LEGLQVIHVGRGIVRCKLTVTHHVLNEDGTLHTAAIGVLMELMGAIAIYSAGGSH--TSVDLNYS 68

  Fly    92 FLNGAKLGDDVVIQANLSKVGK-----YLAFIDCTLKHKKDDLVIAKG 134
            ..:.||:.:::.|:|.:  |||     ..|.|:  ::.:.::.:||.|
plant    69 LYSTAKIQEEIKIEARV--VGKRSENLNSAIIE--IRREYEEELIATG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 29/110 (26%)
AT1G52191NP_001117468.1 PaaI_thioesterase 8..>89 CDD:239527 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21660
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.