DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and ACOT13

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_060943.1 Gene:ACOT13 / 55856 HGNCID:20999 Length:140 Species:Homo sapiens


Alignment Length:130 Identity:51/130 - (39%)
Similarity:81/130 - (62%) Gaps:1/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALM 76
            :.:.:.:.|:..||..|.|:.:|....|....|:||:::|.|....||||...||||.|:|.||:
Human     9 REVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALL 73

  Fly    77 -SKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKYI 140
             ::...||||||:::.:::.||||:|:||.|::.|.||.|||....|.:|....:||:|.|.|::
Human    74 CTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHL 138

  Fly   141  140
            Human   139  138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 46/109 (42%)
ACOT13NP_060943.1 PaaI_thioesterase 25..138 CDD:239527 48/112 (43%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19170545, ECO:0007744|PDB:3F5O 90..95 0/4 (0%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19170545, ECO:0007744|PDB:3F5O 108..113 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158060
Domainoid 1 1.000 64 1.000 Domainoid score I10130
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41273
Inparanoid 1 1.050 98 1.000 Inparanoid score I5025
Isobase 1 0.950 - 0 Normalized mean entropy S4138
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm40609
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - LDO PTHR21660
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.720

Return to query results.
Submit another query.